DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or49a and Or98a

Sequence 1:NP_523711.3 Gene:Or49a FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster

Alignment Length:385 Identity:77/386 (20%)
Similarity:137/386 (35%) Gaps:68/386 (18%)


  Fly    18 FKTLGYDLF----HTPK--------------PWWRYLLVRGYFV--LCTISNFYEASMVTTRIIE 62
            |:...|.:|    |||.              .|....|..|..:  ...|:.|....::|...:.
  Fly    21 FRYFEYGMFCMGWHTPATHKIIYYITSCLIFAWCAVYLPIGIIISFKTDINTFTPNELLTVMQLF 85

  Fly    63 WESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLL-QLSHRLKELYPHKEQNQRKYEVNKY 126
            :.|: |.|.|::     ||.:      :|:.....|:|| ::..|...|....|.:|.....||.
  Fly    86 FNSV-GMPFKVL-----FFNL------YISGFYKAKKLLSEMDKRCTTLKERVEVHQGVVRCNKA 138

  Fly   127 YLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAY 191
            ||         :|.|:.....:...:.:.:.     ||..:   ||:...:.| .|....:..|.
  Fly   139 YL---------IYQFIYTAYTISTFLSAALS-----GKLPW---RIYNPFVDF-RESRSSFWKAA 185

  Fly   192 VIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASI-----RPSPETEQQDCDFLASII 251
            :.:.....|.|..:|.:|::.:.....:.:||..|...:.|:     :...|.||.    |...|
  Fly   186 LNETALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQD----LIKCI 246

  Fly   252 KRHQLMIRLQKDVN-YVFGLLLASNLFTTSCL---LCCMAYYTVVEGFNWEGISYMMLFASVAAQ 312
            |.|.|:|.....:. .|...:....|....||   :..:.::..:    |.|::.:.....:..|
  Fly   247 KDHNLIIDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADI----WTGLATVAYINGLMVQ 307

  Fly   313 FYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIIS 372
            .:.......:|......|..|.|.|.|...|..||..:...:..||:.:..:|..:..||
  Fly   308 TFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPIS 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 59/296 (20%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 66/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50680
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.