| Sequence 1: | NP_523711.3 | Gene: | Or49a / 36350 | FlyBaseID: | FBgn0033727 | Length: | 396 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_524244.2 | Gene: | Or83c / 40744 | FlyBaseID: | FBgn0037399 | Length: | 397 | Species: | Drosophila melanogaster | 
| Alignment Length: | 430 | Identity: | 89/430 - (20%) | 
|---|---|---|---|
| Similarity: | 167/430 - (38%) | Gaps: | 100/430 - (23%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     3 KLRSYEDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRII----EW 63 
  Fly    64 ESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYL 128 
  Fly   129 SCSTRNVLYV-------YYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLT-------- 178 
  Fly   179 FDSEKPLGYVLAYVIDFTYSQFIVNVSL-GTDLWMMCVSSQISMHLGYLANML-ASIRPSPETEQ 241 
  Fly   242 QDCDF-------------------LASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMA 287 
  Fly   288 YYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFES--------KWYEGSL 344 
  Fly   345 RYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITY 384  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Or49a | NP_523711.3 | 7tm_6 | 88..384 | CDD:251636 | 66/339 (19%) | 
| Or83c | NP_524244.2 | 7tm_6 | 69..387 | CDD:251636 | 71/358 (20%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45465548 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR21137 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||