DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or49a and Or67a

Sequence 1:NP_523711.3 Gene:Or49a FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster

Alignment Length:412 Identity:105/413 (25%)
Similarity:187/413 (45%) Gaps:40/413 (10%)


  Fly     2 EKLRSYEDFIFMANMMFKTLGYDLFHTPKP---WWRYLLVRGYFVLCTISNFY-EASMVTTRIIE 62
            ||....:||:.:|...:.|||.|.:.|.:.   |::.......|.:  :.:|| |.:.:..|:.:
  Fly    10 EKYVEVDDFLRLAVKFYNTLGIDPYETGRKRTIWFQIYFALNMFNM--VFSFYAEVATLVDRLRD 72

  Fly    63 WESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQN-QRKYEVNKY 126
            .|:..  .|.|:...:.|..|..|::..:  |..:.::..|..:|:..:|..... |.:|.|..:
  Fly    73 NENFL--ESCILLSYVSFVVMGLSKIGAV--MKKKPKMTALVRQLETCFPSPSAKVQEEYAVKSW 133

  Fly   127 YLSCS--TRNVLYVYYFVMVVMALEPL----VQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPL 185
            ...|.  |:....::..:....||.||    :|..:::   :..|    |:|.|    |...:|.
  Fly   134 LKRCHIYTKGFGGLFMIMYFAHALIPLFIYFIQRVLLH---YPDA----KQIMP----FYQLEPW 187

  Fly   186 GY---VLAYVIDFTYSQFIVNVSLGT---DLWMMCVSSQISMHLGYLANMLASIR----PSPETE 240
            .:   .|.|...|..|......:.|:   ||.:..|..|:.||...||.:|...:    .:|...
  Fly   188 EFRDSWLFYPSYFHQSSAGYTATCGSIAGDLMIFAVVLQVIMHYERLAKVLREFKIQAHNAPNGA 252

  Fly   241 QQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMML 305
            ::|...|.|::..|..::||...:|.|||:.|..| |..|.||.|:....:....:.|.....||
  Fly   253 KEDIRKLQSLVANHIDILRLTDLMNEVFGIPLLLN-FIASALLVCLVGVQLTIALSPEYFCKQML 316

  Fly   306 F-ASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVI 369
            | .||..:.|::.|..|.|||.|.|:..||::..|.....|:||.::.:..::|:|:.:.|..|:
  Fly   317 FLISVLLEVYLLCSFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVL 381

  Fly   370 IISLDTFKILMTITYRFFAVIR 391
            .:|:.|..|.:.::|:||..:|
  Fly   382 DLSMPTMSIFLGMSYKFFCAVR 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 79/314 (25%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 84/337 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133494749
eggNOG 1 0.900 E1_2EMAZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.