DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or49a and Or63a

Sequence 1:NP_523711.3 Gene:Or49a FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster

Alignment Length:442 Identity:89/443 (20%)
Similarity:173/443 (39%) Gaps:80/443 (18%)


  Fly     3 KLRSYEDFIFMANMMFKTLGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLA 67
            |.|:|.....|..:.: |:|::|. .|....:.|  |.:.::.::|:.  ||:..    .|:.||
  Fly    11 KRRNYRSIREMIRLSY-TVGFNLL-DPSRCGQVL--RIWTIVLSVSSL--ASLYG----HWQMLA 65

  Fly    68 GSPSKIMRQG------LHFFYMLSSQLKFI-----TFMINRK----RLLQ---LSHRLKELYPHK 114
            .....|.|.|      |.|...::....|:     .:.:.||    .|||   |..|:.:|...|
  Fly    66 RYIHDIPRIGETAGTALQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIK 130

  Fly   115 E-QNQRKYEVNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIG-FGKADFTYKRIFPTRL 177
            | :.|.:..:|:|:  .|||..:.:|.:..:.:.....:.|.::.|.. |.|...:|..:.|...
  Fly   131 EIRQQVESTMNRYW--ASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPS 193

  Fly   178 TFDS------EKPLGYVLAYVIDFTYSQFIVN---VSLGTDLWMMCVSS-QISMHLGYLANMLAS 232
            .:.:      |.|..::..|:  .|.|.:|..   ||......::|:.| .:...|..:.....|
  Fly   194 LYPAWEHKGLEFPYYHIQMYL--ETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATS 256

  Fly   233 IRPSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNW 297
            ....|:   :..::|...|.::|.:.....:||..|     .::..|..||..         |||
  Fly   257 ELVPPD---RRVEYLRCCIYQYQRVANFATEVNNCF-----RHITFTQFLLSL---------FNW 304

  Fly   298 EGISYM------------------MLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSL 344
             |::..                  |...:...|..|...:||.....|..:|.|.::.:||..|.
  Fly   305 -GLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESR 368

  Fly   345 RYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIRQTVEK 396
            .::..|.:::.:..|...:.....:.:||.|...::..:.::|.:::...:|
  Fly   369 EFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVNQK 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 66/338 (20%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 68/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52889
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.