DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or49a and Or45a

Sequence 1:NP_523711.3 Gene:Or49a FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster

Alignment Length:395 Identity:84/396 (21%)
Similarity:172/396 (43%) Gaps:51/396 (13%)


  Fly    21 LGYDLFHTPKPWWRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAGSPSKIMRQGLHFFYMLS 85
            :|:|. .||:...::.:..|..:|..||:.:  .||...:.:...|    :::......|.....
  Fly    16 VGFDP-STPQLSLKHPIWAGILILSLISHNW--PMVVYALQDLSDL----TRLTDNFAVFMQGSQ 73

  Fly    86 SQLKFITFMINRKRLLQLSHRLKELYP-------HKEQNQRKYEVNKYYLSCSTRNVLYVYYFVM 143
            |..||:..|..|:|:..|.|||.:|..       |.|:.:|:.:::: |::.|.||..   |.|:
  Fly    74 STFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDR-YVARSFRNAA---YGVI 134

  Fly   144 VVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTF--DSEKPLGYVLAYVIDFTYSQFIVNVSL 206
            ...|:.|:    ::.|.|:.:.. .:....|....|  |..||..|...||...........:::
  Fly   135 CASAIAPM----LLGLWGYVETG-VFTPTTPMEFNFWLDERKPHFYWPIYVWGVLGVAAAAWLAI 194

  Fly   207 GTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCD----FLASIIKRHQLMIRLQKDVNYV 267
            .||.....::..:.:....|..:|         |::|.:    .|...:.||::.:.|.|:::.:
  Fly   195 ATDTLFSWLTHNVVIQFQLLELVL---------EEKDLNGGDSRLTGFVSRHRIALDLAKELSSI 250

  Fly   268 FGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFAS--VAAQFYVVSSH---GQMLIDLS 327
            ||.::......:...||.:|:     .|:..|.|..:.|.:  :.|....:||:   |:.:...|
  Fly   251 FGEIVFVKYMLSYLQLCMLAF-----RFSRSGWSAQVPFRATFLVAIIIQLSSYCYGGEYIKQQS 310

  Fly   328 TNLAKAAF-ESKWYEGSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIR 391
            ..:|:|.: :..|.|.:.:.::...:::.:||||.:|.. .:.::.|.....::.....|.|::|
  Fly   311 LAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFG-FMFVVDLPLLLWVIRTAGSFLAMLR 374

  Fly   392 QTVEK 396
             |.|:
  Fly   375 -TFER 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 66/315 (21%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 68/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C52308
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.