DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or49a and Or43b

Sequence 1:NP_523711.3 Gene:Or49a FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster

Alignment Length:352 Identity:71/353 (20%)
Similarity:138/353 (39%) Gaps:62/353 (18%)


  Fly    66 LAGSPSKIMRQGLHFFYMLSS---QLKFITFMINRKRLLQLSHRLKEL--YPHKEQNQRKYE--- 122
            ||..|.:::.|.|..  .|::   .|||.|.::...||...:....||  |..|...:||..   
  Fly    72 LAEFPPELLLQSLQL--CLNTWCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVRDMV 134

  Fly   123 --VNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPL 185
              :.:.||   |..|:||.|      |...|:...:.:.:       .|...:|. :.:..::..
  Fly   135 ATITRLYL---TFVVVYVLY------ATSTLLDGLLHHRV-------PYNTYYPF-INWRVDRTQ 182

  Fly   186 GYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQDCDF---- 246
            .|:.:::..||.. :.:.|:..||.:.:...:.:..|:..|.:.:..:.........|..:    
  Fly   183 MYIQSFLEYFTVG-YAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGDPSNEGSSDPSYMFKS 246

  Fly   247 LASIIKRHQLMIRLQKDVN-YVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMMLFASVA 310
            |...||.|:.|:.....:. .:.|.:.|..:...|.|...|.              .|:|||..:
  Fly   247 LVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMI--------------NMVLFADQS 297

  Fly   311 AQF----YVVS---------SHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLE 362
            .:|    ||::         .:...::|....||.|.|.|.|:....||::.::..:.:.|:|:.
  Fly   298 TRFGIVIYVMAVLLQTFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMT 362

  Fly   363 ISARGVIIISLDTFKILMTITYRFFAV 389
            .:|..:..|:|.|...:....:..:|:
  Fly   363 FTAMNIFNINLATNINVAKFAFTVYAI 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 64/321 (20%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 64/321 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51362
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.