DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or49a and Or13a

Sequence 1:NP_523711.3 Gene:Or49a FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_523359.2 Gene:Or13a FlyBaseID:FBgn0030715 Length:418 Species:Drosophila melanogaster

Alignment Length:422 Identity:103/423 (24%)
Similarity:178/423 (42%) Gaps:92/423 (22%)


  Fly    23 YDLFHTPKPW-WRYLLVRGYFVLCTISNFYEASMVTTRIIEWESLAGSPSKIMRQGLHFFYMLSS 86
            :.|..:.:|| .:.||...|.|...   :..||:..|...:...|..:.|.|         ::::
  Fly    25 WPLTESSRPWRSQSLLATAYIVWAW---YVIASVGITISYQTAFLLNNLSDI---------IITT 77

  Fly    87 QLKFITFM--INRKRLLQLSHRLKELYPHKEQNQRK---------YEV-------NKYYLSCSTR 133
            :....|||  :|..||:           |...||||         ||:       |.....|..|
  Fly    78 ENCCTTFMGVLNFVRLI-----------HLRLNQRKFRQLIENFSYEIWIPNSSKNNVAAECRRR 131

  Fly   134 NVLYVYYFVMVVMALEPLVQSCIMYL--IGFGKA------DFTYKRIFPTRLTFDSEKP-LGYVL 189
               .|.:.:|..:....::..|::.|  |.||.|      .|.||.|||    :|::.. :.||:
  Fly   132 ---MVTFSIMTSLLACLIIMYCVLPLVEIFFGPAFDAQNKPFPYKMIFP----YDAQSSWIRYVM 189

  Fly   190 AYVIDFT-YSQFIVNVSL---GTDLWMMCVSSQISMHL------GYLANMLASIRPSPETEQQDC 244
            .|:  || |:...|..:|   .|.|......:....||      |..|...|.:..|.:.|:   
  Fly   190 TYI--FTSYAGICVVTTLFAEDTILGFFITYTCGQFHLLHQRIAGLFAGSNAELAESIQLER--- 249

  Fly   245 DFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNW---EGISYMMLF 306
              |..|:::|..:|...|.:...|..:|.:||..:|.|: ||..:.:|.|.|.   :.:.:::..
  Fly   250 --LKRIVEKHNNIISFAKRLEDFFNPILLANLMISSVLI-CMVGFQIVTGKNMFIGDYVKFIIYI 311

  Fly   307 ASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGS------------LRYKKEILILMAQAQR 359
            :|..:|.||:..:|..||..||..|:..:|.:| |||            .|.:.:|..::..:|:
  Fly   312 SSALSQLYVLCENGDALIKQSTLTAQILYECQW-EGSDRIEIQSFTPTTKRIRNQIWFMILCSQQ 375

  Fly   360 PLEISARGVIIISLDTFKILMTITYRFFAVIR 391
            |:.|:|.....:||.:|..:::.:..:|.::|
  Fly   376 PVRITAFKFSTLSLQSFTAILSTSISYFTLLR 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 88/348 (25%)
Or13aNP_523359.2 7tm_6 78..399 CDD:251636 88/348 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133495449
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.