DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr49Ac and Cpr65Ax2

Sequence 1:NP_725150.2 Gene:Cpr49Ac FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001261467.1 Gene:Cpr65Ax2 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster

Alignment Length:73 Identity:25/74 (34%)
Similarity:36/74 (49%) Gaps:8/74 (11%)


  Fly   173 DKYDHSYLTENGIYGEEQAKLHHTG------GTHAKGFYEYTGDDGKLYRVNYASNDGGFMPQGD 231
            |.|.::..|.:|....|:..|.:.|      .||  |.:.|.|.||:.|.|.|.:::.||.|||.
  Fly    32 DNYSYAVETSDGTSKSEEGVLKNAGTELEAISTH--GSFSYVGPDGQTYTVTYVADENGFQPQGA 94

  Fly   232 HIHPIPDA 239
            |:...|.|
  Fly    95 HLPVAPVA 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 17/57 (30%)
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.