DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr49Ac and Lcp65Ae

Sequence 1:NP_725150.2 Gene:Cpr49Ac FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster

Alignment Length:76 Identity:21/77 (27%)
Similarity:39/77 (51%) Gaps:4/77 (5%)


  Fly   162 KILHKEEVRKQDKYDHSYLTENGIYGEEQAKLHHTGGTH----AKGFYEYTGDDGKLYRVNYASN 222
            :|::.|.....:.:..|:.|.:|.....:.:|.:....|    .:|.:.:..|||:.|.|||.::
  Fly    20 QIINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQGSFRFVADDGQTYEVNYIAD 84

  Fly   223 DGGFMPQGDHI 233
            :.||.|||.|:
  Fly    85 ENGFQPQGAHL 95

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 14/55 (25%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:278791 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.