DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr49Ac and Cpr67Fa2

Sequence 1:NP_725150.2 Gene:Cpr49Ac FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_648419.1 Gene:Cpr67Fa2 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster

Alignment Length:95 Identity:29/96 (30%)
Similarity:55/96 (57%) Gaps:14/96 (15%)


  Fly   168 EVRKQDKYDHSYLTENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRVNYASNDGGFMPQGDH 232
            :::.:..|::.|.|.|||..:|..    .||.||.|.:.:...:|:|.:::|.:::.|:.|||..
  Fly    35 DIQPEGNYNYQYETSNGIAAQESG----IGGNHANGGFSWYSPEGELVQISYVADENGYQPQGAL 95

  Fly   233 I---HPIPDAIVRAL-------KYVEEQHK 252
            :   .|||.||:|:|       :|||::::
  Fly    96 LPTPPPIPAAILRSLEYIRTHPQYVEQEYR 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 16/51 (31%)
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47876
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.