DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr49Ac and CG1136

Sequence 1:NP_725150.2 Gene:Cpr49Ac FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_647853.1 Gene:CG1136 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster

Alignment Length:144 Identity:31/145 (21%)
Similarity:40/145 (28%) Gaps:69/145 (48%)


  Fly    42 KYRPSDDG-KYHGNSQNEGRSGSQESIGRYHHMPIPYRHVSDQRELGKYHHIPYPYDGGYGPYAG 105
            |..|:..| ..||     |.|||..:                  .||.||...|.|..       
  Fly   107 KAAPAQSGVLVHG-----GSSGSSAN------------------SLGSYHRPSYGYIS------- 141

  Fly   106 SNIPYVHDDRPYNHDLYTSTTTKKPTTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKILH----- 165
                                           :||||||....|...|.:.:|.|..|:.:     
  Fly   142 -------------------------------STTSTTTPAPYPPPALLDVEDSGAGKLNYLPPEQ 175

  Fly   166 --KEEVRKQDKYDH 177
              |.|.:.|..:||
  Fly   176 AAKIEPQSQLGFDH 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 2/4 (50%)
CG1136NP_647853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.