DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr49Ac and Cpr49Ah

Sequence 1:NP_725150.2 Gene:Cpr49Ac FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster

Alignment Length:225 Identity:52/226 (23%)
Similarity:81/226 (36%) Gaps:62/226 (27%)


  Fly    87 GKYHHIPYPYDGGYGPYAGSNIPYVHDDRP--YNHDLYTSTTTKKPTTTTKRTTTSTTTTTTTPR 149
            |::||       .:.....:|||  .||:|  :.|:.:..|:|..|.                  
  Fly    16 GQHHH-------QHQHQNVNNIP--RDDKPDHHRHEDHRETSTWIPI------------------ 53

  Fly   150 NILFNYDDEGRHKILHKEEVRKQDKYDHSYLTENGIYGEEQAKL-----HHTGGTHAKGFYEYTG 209
                         |.:.:|......|...|.|.|.|..||...|     :..|.....|.|.|..
  Fly    54 -------------IKYNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQS 105

  Fly   210 DDGKLYRVNYASNDGGFMPQGDHIHPIPDAIVRALKYVEEQHKINGGAQFDHRGFRINHMTKDLK 274
            .:|.|..|.|.:::.||...|||| |.|.||         ..:|..|....:.|.::.....:.:
  Fly   106 PEGTLVNVQYTADENGFRATGDHI-PTPPAI---------PEEIQKGLDQIYAGIKLQQERLEQR 160

  Fly   275 AQIK---AIHLEE--MPKELTEQIHMLEHE 299
            |:..   |..|||  :..:..:.|.:||::
  Fly   161 AKTDPDFARKLEERRVANQNGQYIGLLENQ 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 17/56 (30%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:278791 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.