DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr49Ac and Cpr12A

DIOPT Version :10

Sequence 1:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:78 Identity:18/78 - (23%)
Similarity:35/78 - (44%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KILHKEEVRKQD-KYDHSYLTENGIYGEEQ---AKLHHTGGTHAKGFYEYTGDDGKLYRVNYASN 222
            ::|.:.:.|..| .|::.:..::|....|:   .|::........|:|.|...||:...|.|.::
  Fly    32 RLLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKINDVKTLMVVGYYAYRMTDGRYITVFYNAD 96

  Fly   223 DGGFMPQGDHIHP 235
            ..|:. |...|.|
  Fly    97 QFGYR-QNQSITP 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:459790 11/53 (21%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 11/53 (21%)

Return to query results.
Submit another query.