DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr49Ac and Cpr12A

Sequence 1:NP_725150.2 Gene:Cpr49Ac FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster

Alignment Length:78 Identity:18/79 (23%)
Similarity:35/79 (44%) Gaps:5/79 (6%)


  Fly   162 KILHKEEVRKQD-KYDHSYLTENGIYGEEQ---AKLHHTGGTHAKGFYEYTGDDGKLYRVNYASN 222
            ::|.:.:.|..| .|::.:..::|....|:   .|::........|:|.|...||:...|.|.::
  Fly    32 RLLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKINDVKTLMVVGYYAYRMTDGRYITVFYNAD 96

  Fly   223 DGGFMPQGDHIHP 235
            ..|:. |...|.|
  Fly    97 QFGYR-QNQSITP 108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 12/54 (22%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:278791 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47766
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10380
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.