DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8839 and FAAH2

Sequence 1:NP_610764.1 Gene:CG8839 FlyBaseID:FBgn0033717 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_777572.2 Gene:FAAH2 HGNCID:26440 Length:532 Species:Homo sapiens

Alignment Length:522 Identity:235/523 (45%)
Similarity:328/523 (63%) Gaps:19/523 (4%)


  Fly    13 GYIFGIL-QACIRFVFRLIYGQK--GESVPPITDAILLESATSLARKIRKQELSSVQVLESFIRR 74
            |::.|:: :|.:     ::.|.|  .::..|:|:.:||.|...||:.||::::..:.|::::|.|
Human    18 GFLIGLVGRAAL-----VLGGPKFASKTPRPVTEPLLLLSGMQLAKLIRQRKVKCIDVVQAYINR 77

  Fly    75 IKEVNPILNCVVDERYDQALKEAAEADALIKSGQYSTEELEKEKPFLGVPITTKDCISVKGMLHT 139
            ||:|||::|.:|..|:::|:|||...|..:...|.....||.:.||||||:|.|:...::||.::
Human    78 IKDVNPMINGIVKYRFEEAMKEAHAVDQKLAEKQEDEATLENKWPFLGVPLTVKEAFQLQGMPNS 142

  Fly   140 AGLFERRDVRAARDADAMALMRKAGAIPIALTNVSEVCMWWESNNTVHGRTRNAYDTNRIVGGSS 204
            :||..|||..|..||..:||::.|||||:.:||.||:|||:||:|.::||:.|.||...||||||
Human   143 SGLMNRRDAIAKTDATVVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQHIVGGSS 207

  Fly   205 GGEGCIQSAAASAFGLGSDIGGSIRMPAFFNGIFGHKPSKLVVSNVGQFPAPFSAEQNSFLGLGP 269
            |||||..:||.|..|:|||||||||||||||||||||||..||.|.||||....| |..||..||
Human   208 GGEGCTLAAACSVIGVGSDIGGSIRMPAFFNGIFGHKPSPGVVPNKGQFPLAVGA-QELFLCTGP 271

  Fly   270 MSRFAEDLRPMLKIMAGEKAALLNLDEDVDLTKMKFFYQESDGGGRLVSAVDPDLREAMNRVAQH 334
            |.|:||||.||||:|||.....|.||..|.|..:||::.|.|||..|:|.||.||.....:|..|
Human   272 MCRYAEDLAPMLKVMAGPGIKRLKLDTKVHLKDLKFYWMEHDGGSFLMSKVDQDLIMTQKKVVVH 336

  Fly   335 LREKFGNQKVERIQLPHFRQSAAIWFANMRDDSGHG------FAYQLGNLNHDINTYLELFKWFF 393
            |....| ..|:.::|...:.|..:|.| |....||.      |...||:....::...||.||..
Human   337 LETILG-ASVQHVKLKKMKYSFQLWIA-MMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCL 399

  Fly   394 GASKHTFIGLSTAIMDSAQCKHGSPKYDHLVRKRNELREELQSLLGDNGVLIYPTHPTVAPYHNE 458
            |.|.:|...:..|:::. :.::.:.||.........||:||..:|||:||.:||:||||||.|:.
Human   400 GLSVYTIPSIGLALLEE-KLRYSNEKYQKFKAVEESLRKELVDMLGDDGVFLYPSHPTVAPKHHV 463

  Fly   459 PITRPINFAYTGIVNVLGFPATAVPLGKLGSEGLPLGVQIIANFNQDRLCLAVAEELERAFGGWA 523
            |:|||.||||||:.:.||.|.|..||| |.::|||||:|::|....|.|.||||:.||:.||||.
Human   464 PLTRPFNFAYTGVFSALGLPVTQCPLG-LNAKGLPLGIQVVAGPFNDHLTLAVAQYLEKTFGGWV 527

  Fly   524 KP 525
            .|
Human   528 CP 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8839NP_610764.1 GatA 42..525 CDD:223232 228/489 (47%)
PRK07488 49..520 CDD:236030 222/477 (47%)
FAAH2NP_777572.2 GatA 48..526 CDD:223232 226/483 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C213543395
eggNOG 1 0.900 E1_COG0154
Hieranoid 1 1.000
Homologene 1 1.000 H45263
Inparanoid 1 1.050 441 1.000 Inparanoid score I1641
Isobase 1 0.950 0.69812 Normalized mean entropy S4795
OMA 1 1.010
OrthoDB 1 1.010 D395077at33208
OrthoFinder 1 1.000 FOG0003208
OrthoInspector 1 1.000 T1073035
orthoMCL 1 0.900 OOG5_132214
Panther 1 1.100 LDO PTHR43372
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R16971
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.