DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and FBXO8

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:NP_036312.2 Gene:FBXO8 / 26269 HGNCID:13587 Length:319 Species:Homo sapiens


Alignment Length:176 Identity:47/176 - (26%)
Similarity:82/176 - (46%) Gaps:20/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   647 LSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNV--DSKI 709
            |.:|:..||..|::|:.|....|||:.  .|.::|.|:.....|:.|.:..|:.::::|  |...
Human   139 LDEGSLTFNANPDEGVNYFMSKGILDD--SPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVT 201

  Fly   710 LINFVDSFDFTGLRVDQALRLYLETFRLPGE-APLIFLVLEHFSDHWHKQNQDPFANV----DAA 769
            |.||.:.|      :..|||.:......|.| ...:..::..||..:...|.|....:    ||.
Human   202 LHNFRNQF------LPNALREFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAV 260

  Fly   770 FRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLR--GLNGGEDF 813
            :.|.|::|:|::|..:.:.|.   .|:..:|.:|.|  ..|..|||
Human   261 YVLCYSLILLSIDLTSPHVKN---KMSKREFIRNTRRAAQNISEDF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 47/176 (27%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 47/176 (27%)
FBXO8NP_036312.2 F-box-like 74..112 CDD:372399
Sec7 133..312 CDD:238100 47/176 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.