DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: garz and Iqsec1

Sequence 1:NP_610761.2 Gene:garz FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_006506046.1 Gene:Iqsec1 MGIID:1196356 Length:1203 Species:Mus musculus

Alignment Length:794 Identity:192/795 (24%)
Similarity:302/795 (38%) Gaps:243/795 (31%)


  Fly   173 PRL---SELLRRSAE-------KSLKDMVLLFFMRLPQFAEERSDTMLQKRF-----------TI 216
            |||   :.:||:.||       :||.:.     ..|....:::...||::::           ||
Mouse   171 PRLQHSTSVLRKQAEEEAIKRSRSLSES-----YELSSDLQDKQVEMLERKYGGRLVTRHAARTI 230

  Fly   217 GDA-------------ASGATQEKLKRKTVAQAQTAPRKSSAVEEPPQTPQS------ANLT--- 259
            ..|             .|..::.::.|:.|....   |...:.|.|.:...|      .::|   
Mouse   231 QTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNM---RMQFSFEGPEKVHSSYFEGKQVSVTNDG 292

  Fly   260 ------VP---GHLKAPIL-ATTPASP-AGNILDMQGKITQTPTTTASTGED--------ETTVP 305
                  ||   |.|..|.| :..|:|. |..|.:::...::...:.|.:.:|        ...||
Mouse   293 SQLGALVPSECGDLSDPALKSPAPSSDFADAITELEDAFSRQVKSLAESIDDALNCRSLHSEEVP 357

  Fly   306 ETPVIQVESTESEPLLDG----ETGEATSTLAEANSSEYINSVGVRFTQQSTDHDVTSLSPYGLP 366
            .:...:...||.:|.|.|    :..|.|::.::.  :.||              |...||| .||
Mouse   358 ASDTARARDTEPKPGLHGMDHRKLDEMTASYSDV--TLYI--------------DEEELSP-PLP 405

  Fly   367 FIQELFRFLIILCNPLDKQNSDSMMHTGLSLLTVAFEVAADNIGKYEGLLELVKDD------LCR 425
            ..|...|       | ....||..:.:|        ..|.|    |..|..  |:|      .||
Mouse   406 LSQAGDR-------P-SSTESDLRLRSG--------GAAQD----YWALAH--KEDKADTDTSCR 448

  Fly   426 NLISLLSSE-RLSIFAADLQLCFLLFE------------SLRGHLKFQLEAYLRKLSEIIASDN- 476
            :..||...| ||.:    ..|..|..|            |.|..||.| .||.|.|.....|.. 
Mouse   449 STPSLERPEPRLRV----EHLPLLTIEPPSDSSVELSDRSDRSSLKRQ-SAYERSLGGQQGSPKH 508

  Fly   477 ------PK-TPYEMRELALDNLLQLWRIP-GFVTELYINYDCDLYCTDMFESLTNLLSK----YT 529
                  || .|.|..||..       |.| ...:.|.||            ...|..||    |:
Mouse   509 GPHGGPPKGLPREEPELRP-------RPPRPLESHLAIN------------GSANRQSKSESDYS 554

  Fly   530 LSATNAVYSTHIISMDTLLSVIDSIERNCAASKNSSNNRESLPEAAPATGGSRHSRHNSGLEGIV 594
            ....:::.||. .|.||:         ||:   :.|::|:||.|..                   
Mouse   555 DGDNDSINSTS-NSNDTI---------NCS---SESSSRDSLREQT------------------- 587

  Fly   595 IDSGNSVAAEEKVENIASFINASSHRLRLQSGGEGVGITSEQLAKVKQKKRLLSQGTERFNQRPE 659
                               ::..::....::..:....:::.:     :||....|...||::||
Mouse   588 -------------------LSKQTYHKETRNSWDSPAFSNDVI-----RKRHYRIGLNLFNKKPE 628

  Fly   660 KGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYI-SKKKNVDSKILINFVDSFDFTGLR 723
            ||||||.|.|.:..  .|:.||.||.:..||.::||||:: :::|..:..:|...||..||:.:.
Mouse   629 KGIQYLIERGFVPD--TPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAME 691

  Fly   724 VDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQD---PFANVDAAFRLAYAIIMLNMDQHN 785
            :|:|||.:....|:.|||..:..::|.||..:...|..   .|.|.|..|.||:|||:||.|.::
Mouse   692 LDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCVCNPGVVRQFRNPDTIFILAFAIILLNTDMYS 756

  Fly   786 SNAKRLNVP---MTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNEEIVMPAEQTGLVRENYQWK 847
            .|.|    |   |.||||.|||||::.|||..:|.|..::..|:..|:....:....|::  ..|
Mouse   757 PNVK----PERKMKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNEDHVSQVQK--VEK 815

  Fly   848 VLLRR---GDTHDG 858
            :::.:   |..|.|
Mouse   816 LIVGKKPIGSLHHG 829

Known Domains:


GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 146/556 (26%)
Sec7_N 370..512 CDD:289549 42/170 (25%)
Sec7 643..830 CDD:279680 76/194 (39%)
Iqsec1XP_006506046.1 Sec7 612..800 CDD:279680 76/194 (39%)
PH_IQSEC 837..967 CDD:270128
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85418211
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.