DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: garz and MON2

Sequence 1:NP_610761.2 Gene:garz FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_016874530.1 Gene:MON2 HGNCID:29177 Length:1718 Species:Homo sapiens

Alignment Length:1928 Identity:314/1929 (16%)
Similarity:592/1929 (31%) Gaps:711/1929 (37%)


  Fly    69 PFLEVIRTADATGPLTSLALASVNKLLSYGLIDPTSP-NLADIVERIADAVTHARFMGTDQSSDG 132
            |||....|.:.  .:|.|.||::.:|:|:.::..|:. |:.:::.::           .:.|.:.
Human    70 PFLMGCGTKEP--KITQLCLAAIQRLMSHEVVSETAAGNIINMLWQL-----------MENSLEE 121

  Fly   133 VTFMRVIEVLHTLIRSPEGAAVSNVSMCEVMLSCFKISFEPRLSELLRRSAEKSLKDMVLLFFMR 197
            :..::.:.||.|     ....|.:.::.:.::.||::.|..  ..:...:|..:::.:|.:.|.|
Human   122 LKLLQTVLVLLT-----TNTVVHDEALSKAIVLCFRLHFTK--DNITNNTAAATVRQVVTVVFER 179

  Fly   198 LPQFAEERSDTMLQKRFTIGDAASGATQEKLKRKTVAQAQTAPRKSSAVEEPPQTPQSANLTVPG 262
            :....|...|.:.|.....|::         .|::|:..:...:.:..:.:  ...|..|...|.
Human   180 MVAEDERHRDIIEQPVLVQGNS---------NRRSVSTLKPCAKDAYMLFQ--DLCQLVNADAPY 233

  Fly   263 HLKAPILATTPASPAGNILDMQGKITQTPTTTASTGEDETTVPETPVIQVESTESEPLLDGETGE 327
            .|..                    :|:. |.|......|:.:.:.|.:.::..|...||......
Human   234 WLVG--------------------MTEM-TRTFGLELLESVLNDFPQVFLQHQEFSFLLKERVCP 277

  Fly   328 ATSTLAEANSSEYINSVGVRFTQQSTDHDVTSLSPYGLPFIQELFRFLIILCNPLDKQNSDSMMH 392
            ....|...|         ::|.|.|:    ||.||                 .|::|...     
Human   278 LVIKLFSPN---------IKFRQGSS----TSSSP-----------------APVEKPYF----- 307

  Fly   393 TGLSLLTVAFEVAADNIGKYEGLLELVKDDLCRNLISLLSSERLSIFAADLQLCFLLFESLRGHL 457
                                         .:|..|:.::|               :|.:.....|
Human   308 -----------------------------PICMRLLRVVS---------------VLIKQFYSLL 328

  Fly   458 KFQLEAYLRKLSEIIASDNPKTPYEMRELALDNLLQLWRIPGFVTELYINYDCDLYCTDMFESLT 522
            ..:.|.:|..|.:.:.:|.|:.   :|.:|::::.:....|..:.....:||...:.|.:|..:.
Human   329 VTECEIFLSLLVKFLDADKPQW---LRAVAVESIHRFCVQPQLLRSFCQSYDMKQHSTKVFRDIV 390

  Fly   523 NLLSKYTLSATNAVYSTHIISMDTLLSVIDSIERNCAASKNSSNNRESLPEAAPATGGSRHSRHN 587
            |.|..:       :.|..::..          ..|.|.|..:.||.         .|||..:..|
Human   391 NALGSF-------IQSLFLVPP----------TGNPATSNQAGNNN---------LGGSVSAPAN 429

  Fly   588 SGLEGIVIDSGNSVAAEEKVENIASFINASSHRLRLQSGGEGVGITSEQLAKVKQKKRLLSQGTE 652
            ||:.||                                   |.|:|                   
Human   430 SGMVGI-----------------------------------GGGVT------------------- 440

  Fly   653 RFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKILINFVDSF 717
                                                                        .:.:|
Human   441 ------------------------------------------------------------LLPAF 445

  Fly   718 DFTGLRVDQALRLYLETFRLPGEAPLIFL-VLEHFSDHWHKQNQDPFANVDAAFRLAYAIIMLNM 781
            ::.|..:.      :.|..:.|.|...:| :|:        :.:.|......|..:|:..::   
Human   446 EYRGTWIP------ILTITVQGSAKATYLEMLD--------KVEPPTIPEGYAMSVAFHCLL--- 493

  Fly   782 DQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNEEIVMPAEQTGLVRENYQW 846
                             |..:.:..:..||..:.|...|.    ..||...|.:.|       :.
Human   494 -----------------DLVRGITSMIEGELGELETECQT----TTEEGSSPTQST-------EQ 530

  Fly   847 KVLLRRGDTHDGHFHYVHDASYDVEIFNIVWGASLSALSFMFDKST-ETGYQRTLAGFSKSAAIS 910
            :.|....|..|...  |..|.:: |:.|..|...|:|||.:.|.|| |...:..|......||:.
Human   531 QDLQSTSDQMDKEI--VSRAVWE-EMVNACWCGLLAALSLLLDASTDEAATENILKAELTMAALC 592

  Fly   911 AHYNLHSDFDALVLTLCKFT-------TLLS------------SVEQHEP---APANNETQQAVN 953
            ....|.:..||.:..:||.:       |:|:            ||:....   :|::...||.|.
Human   593 GRLGLVTSRDAFITAICKGSLPPHYALTVLNTTTAATLSNKSYSVQGQSVMMISPSSESHQQVVA 657

  Fly   954 FG------------LNGKAQAAMRTVFLLVHDYGDCLRESWKHIL-DLYLQLFRLKLLPKSLIEV 1005
            .|            |..|....|||:..|.|.:|..|..||:.:| .|...::.|.|.|.|    
Human   658 VGQPLAVQPQGTVMLTSKNIQCMRTLLNLAHCHGAVLGTSWQLVLATLQHLVWILGLKPSS---- 718

  Fly  1006 EDFCEANGKAM---LILEKPREKQESGLFSSLYSFISSEGQREPTYEEQDFIKLGRKCIKECQLD 1067
                   |.|:   ..:|.|.....:.:.:.| ..||:                        .|.
Human   719 -------GGALKPGRAVEGPSTVLTTAVMTDL-PVISN------------------------ILS 751

  Fly  1068 QMLQESKFVQLESLQELLK--CVLALLKAPQGHKSIGLPYA--EDQTVFWMEFLVKIVVHNRDRM 1128
            ::.:.|:::...||..|:.  |.|:|       :::.:.|.  ::.::|.:..|::..:.|..|:
Human   752 RLFESSQYLDDVSLHHLINALCSLSL-------EAMDMAYGNNKEPSLFAVAKLLETGLVNMHRI 809

  Fly  1129 IPLWPAVRDQMYLLLMGSASCGYDYLLNR-----CIVAVLKLAIY------LMRNEELCPIVLQS 1182
            ..||..:...:.     ...|.:.....|     .:.:::|..:.      |.:|:.|..::|..
Human   810 EILWRPLTGHLL-----EKVCQHPNSRMREWGAEALTSLIKAGLTFNHDPPLSQNQRLQLLLLNP 869

  Fly  1183 LKMLLMLK-PALLLRISKQISIGIYELLKTSAQNIHSEQDWQIIFNLLECV----GAGAVPPNYD 1242
            ||.:..:. |.:.|   ||:.. :.::|::...::  ...|.::..::..:    |...:...:.
Human   870 LKEMSNINHPDIRL---KQLEC-VLQILQSQGDSL--GPGWPLVLGVMGAIRNDQGESLIRTAFQ 928

  Fly  1243 DAQ------LPLPP---------------------NGSAKSDGAISGEEDATAVPERGYTSDSEI 1280
            ..|      ||..|                     |.|..|.|.:....|...  :||.|.:.|:
Human   929 CLQLVVTDFLPTMPCTCLQIVVDVAGSFGLHNQELNISLTSIGLLWNISDYFF--QRGETIEKEL 991

  Fly  1281 TKASAA--------------PAVSSPSAE-NWILVNNKDSELTTASRPQSPPSLSAPPVNTLVYN 1330
            .|..||              |...:|..: .|:.:..|..||....||....|......:|:..:
Human   992 NKEEAAQQKQAEEKGVVLNRPFHPAPPFDCLWLCLYAKLGELCVDPRPAVRKSAGQTLFSTIGAH 1056

  Fly  1331 CQLLDHAPFALFKCWDSLAFIVRSVAHITPYNFEACVRCIRIFVEACRDGGIRQRRKLESAAKQK 1395
            ..||.|:      .|.::  |.:.:.|:..                      |.|....:|.|:|
Human  1057 GTLLQHS------TWHTV--IWKVLFHLLD----------------------RVRESSTTADKEK 1091

  Fly  1396 SSKKRSERKPGMASSASSSNLTLLTGDPSDNQINGNAAEQEDLAQRYEQLSIQLLDLMYTLYTRT 1460
                         ..:...|:.:              ....|.|::      |..:.........
Human  1092 -------------IESGGGNILI--------------HHSRDTAEK------QWAETWVLTLAGV 1123

  Fly  1461 AQIF---RWWAEEGCTVPQSAALWSPGWCPLLQGIARLAMDRRREVRTHAISCLQQRALLVHDLQ 1522
            |:||   |:       :.|....:|..|..||..|...|:.:..||...|:...|:         
Human  1124 ARIFNTRRY-------LLQPLGDFSRAWDVLLDHIQSAALSKNNEVSLAALKSFQE--------- 1172

  Fly  1523 TLSGTEWCSCFHQVLFPLLNELLPESNAAGQLDAALLEESRIRTATIMSKVFLQHLTTLIELGNA 1587
                      ..|::.|:.:...||:.....:...:|    |...:.||:.|::..:...:||  
Human  1173 ----------ILQIVSPVRDSDKPETPPVVNVPVPVL----IGPISGMSRPFVRTDSIGEKLG-- 1221

  Fly  1588 FNELWLDILDYIERFMKVGSDTLSEQMQEILKNMLLVMHSVRVFHNQDGSLQQALWELTWRRIGE 1652
                         |:.......::::::::                   :|..|.|. ||.|||.
Human  1222 -------------RYSSSEPPIVTDELEDL-------------------NLWWAAWN-TWYRIGS 1253

  Fly  1653 FLPNLKEELFHDEGKRAQTLTNPAPQAAVAAAPQQQLPAVTILPRQTQVSNELVVSAPTPPAATP 1717
                                             :...|.:|.         :.:...|:.|..|.
Human  1254 ---------------------------------ESTKPPITF---------DKLTFIPSQPFLTA 1276

  Fly  1718 LL------------GSPVESPRR------SIILQPPMADVLQQPPSFVFAQPIIVPPQPPAVTDP 1764
            |:            |..::..::      |.|..|..:|          |.|.|:|....||.  
Human  1277 LIQIFPALYQHIKTGFNMDDLQKLGVILHSAISVPISSD----------ASPFILPSYTEAVL-- 1329

  Fly  1765 IPPSTLLPDLVNEATAAAVQATTTSPTHSPQEAEQPASIVQQTNIVTTNNTYNSYAIEVPMAPET 1829
                |.|.:.|..|.....:|....|.:  .:...||...|....|       .::.:.|     
Human  1330 ----TSLQEAVLTALDVLQKAICVGPEN--MQIMYPAIFDQLLAFV-------EFSCKPP----- 1376

  Fly  1830 TAEQFGQQQQQLLYQQYYQQYQAQQQQLPAPASDPAIN-VPIS 1871
               |:||.:.:.:....|.|.     ||.|||...|:| ||.:
Human  1377 ---QYGQLETKHIANAKYNQI-----QLFAPAEWVALNYVPFA 1411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 121/756 (16%)
Sec7_N 370..512 CDD:289549 17/142 (12%)
Sec7 643..830 CDD:279680 17/188 (9%)
MON2XP_016874530.1 DCB 9..183 CDD:292830 24/133 (18%)
Sec7_N 212..379 CDD:289549 38/272 (14%)
DUF1981 <873..932 CDD:286414 8/65 (12%)
Mon2_C 935..1709 CDD:292823 117/688 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.