DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: garz and gbf1

Sequence 1:NP_610761.2 Gene:garz FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_012822305.1 Gene:gbf1 XenbaseID:XB-GENE-1012128 Length:1857 Species:Xenopus tropicalis

Alignment Length:1934 Identity:830/1935 (43%)
Similarity:1156/1935 (60%) Gaps:215/1935 (11%)


  Fly     8 IYVVRGEMATLMTAMRRGTRWNATAYVDDENDSLLKLFIDLKHELNRIEDLRQIEPQVFLAPFLE 72
            ||:|:||::.::.|::|..||:....||:|.|.||..|..||..||.|::|.:|||.|||.||||
 Frog     6 IYIVQGEISIVVGAIKRNARWSMHTPVDEEQDPLLHSFSVLKEVLNNIKELSEIEPNVFLRPFLE 70

  Fly    73 VIRTADATGPLTSLALASVNKLLSYGLIDPTSPNLADIVERIADAVTHARFMGTDQSSDGVTFMR 137
            |||:.|.|||:|.|||.||||.|||.||||:....|:.:|.:|||||||||:|||.:||.|..|:
 Frog    71 VIRSEDTTGPITGLALTSVNKFLSYALIDPSHEGTAEGIENMADAVTHARFVGTDPASDEVVLMK 135

  Fly   138 VIEVLHTLIRSPEGAAVSNVSMCEVMLSCFKISFEPRLSELLRRSAEKSLKDMVLLFFMRLPQFA 202
            :::||.||:.:|.||.::|.|:||:|.|||:|.||.|||||||:|||.:|.|||.|.|.|||||.
 Frog   136 ILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKSAEHTLVDMVQLLFSRLPQFK 200

  Fly   203 EERSD---TMLQKRFTIGDAASGATQEKLKRKTVAQAQTAPRKSSAVEEPPQTPQSANLTVPGHL 264
            ||...   |.::|........|.:::.|.::|:..|.:...:..:|.|...|.|.....|:..:|
 Frog   201 EEAKSYIGTNMKKLKMRAGGMSDSSKWKKQKKSPRQPRHVTKAMAAAEPSSQQPVVNGTTITTNL 265

  Fly   265 KAPILATTPASPAGN--ILDMQGKITQ---TPTT--------TASTGEDETTV-PETPVI----- 310
            ...:.....:||..|  |..:..:.|.   :|||        .|::.||.:.: |.:|.:     
 Frog   266 TGEVPFIDASSPDANFPISGVSSEATSAVVSPTTDSGVDMSSQATSKEDLSELDPASPSLSAIQQ 330

  Fly   311 ---------------QVE----------STESEP-LLDGETGEA-TSTLAEANSSEYINSVGVRF 348
                           ::|          |.||.| :||.....| .|..|..:..:|:|..||||
 Frog   331 SGDICLSEQQNQDDDKIEDLMERHTYSASVESIPEVLDDNVSLADQSDSASVHDMDYVNPRGVRF 395

  Fly   349 TQQSTDHDVTSLSPYGLPFIQELFRFLIILCNPLDKQNSDSMMHTGLSLLTVAFEVAADNIGKYE 413
            | ||:..:.|.|.|||||.|:|||||||.|.||.|:.||:.|:|.||.|:|||.|.|.  |..|.
 Frog   396 T-QSSQKEGTVLVPYGLPCIRELFRFLISLTNPHDRHNSEVMIHMGLQLITVALESAP--IENYV 457

  Fly   414 GLLELVKDDLCRNLISLLSSERLSIFAADLQLCFLLFESLRGHLKFQLEAYLRKLSEIIASDNPK 478
            .||.||||:|||:|..|||.|||:::||.|:.||||||.:|.|||||||.|::||.:||..:|||
 Frog   458 SLLGLVKDELCRHLFQLLSIERLNLYAASLRACFLLFEGMREHLKFQLEMYIKKLMDIITVENPK 522

  Fly   479 TPYEMRELALDNLLQLWRIPGFVTELYINYDCDLYCTDMFESLTNLLSKYTLSATNAVYSTHIIS 543
            .||||:|:||:.::||||||.||||||||||||.||:::||.||.||||.....:..:|:||::|
 Frog   523 MPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQLYTTHLLS 587

  Fly   544 MDTLLSVIDSIERNCAASKNSSNNRESLPEAAPATGGSRHSRHNSGLEGIVIDSGNSVAAEEK-- 606
            ::.||:||||.|.:|.| ||.||..:...|....:|.......:||       :.|..:.|.|  
 Frog   588 LEALLTVIDSTESHCQA-KNLSNVSQDKKETGKPSGDLSEGTKDSG-------NLNEHSIEVKPF 644

  Fly   607 ---VENIASFINASSH------RLRLQ------SGGEGVGITS-----------EQLAKVKQKKR 645
               .||..|....|.|      .|.:|      .|||...:..           ::|..:|.||:
 Frog   645 TVSAENNGSKPPTSGHLMADKMTLGVQETEYSTDGGEKKTLKKPQRFSCLLPNVQELNDIKTKKK 709

  Fly   646 LLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIGEYISKKKNVDSKIL 710
            ||..|||:|||:|:||:|:|||..:|...:|..:||.:|||||.||||||||::|.:||:|  :|
 Frog   710 LLITGTEQFNQKPKKGVQFLQEKDLLATPMDNAEVAQWLRENPRLDKKMIGEFVSDRKNLD--LL 772

  Fly   711 INFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQDPFANVDAAFRLAYA 775
            .:||.:|.|.|||||:|||||||.||||||||:|..:||.|::||.|.|..|||:.||.|.||||
 Frog   773 ESFVGTFHFQGLRVDEALRLYLEAFRLPGEAPVIQRLLEAFTEHWRKSNGTPFAHSDACFALAYA 837

  Fly   776 IIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIKNEEIVMPAEQTGLV 840
            :||||.||||.|.::.|||||||:|.|||:|:|||:||||:||..:::||||||||||.||||||
 Frog   838 VIMLNTDQHNHNVRKQNVPMTLEEFRKNLKGVNGGKDFDQDMLEDIYHAIKNEEIVMPEEQTGLV 902

  Fly   841 RENYQWKVLLRRGDTHDGHFHYVHDASYDVEIFNIVWGASLSALSFMFDKS-TETGYQRTLAGFS 904
            :|||.|.|||.||.|.:|.|.:|...|||.::|.:.||.:::|||::|||| .||..|:.::||.
 Frog   903 KENYFWNVLLHRGATPEGMFLHVDPGSYDHDLFTMTWGPTIAALSYVFDKSMDETIIQKAISGFR 967

  Fly   905 KSAAISAHYNLHSDFDALVLTLCKFTTLLSSVEQHEPAPANNETQQAVNFGLNGKAQAAMRTVFL 969
            |.|.|||||.|...||.|:::|||||||.|...::.|..          ||.|.|||.|.:|||.
 Frog   968 KCAMISAHYGLSDVFDNLIISLCKFTTLSSEAVENLPTV----------FGSNLKAQIAAKTVFH 1022

  Fly   970 LVHDYGDCLRESWKHILDLYLQLFRLKLLPKSLIEVEDFCEANGKAMLILEK-PREKQESGLFSS 1033
            |.|.:||.|||.||:|:|..|||||.:||||:::|||||.:.|||..|..|: |..:.|    |:
 Frog  1023 LSHRHGDILREGWKNIMDSMLQLFRAELLPKAMVEVEDFVDPNGKISLQREEIPANRGE----ST 1083

  Fly  1034 LYSFIS--------SEGQREPTYEEQDFIKLGRKCIKECQLDQMLQESKFVQLESLQELLKCVLA 1090
            :.||:|        ....|.|:.|.|:..||..:|||.|..::::.||||:||||||||:|.:::
 Frog  1084 VLSFVSWLTLSGTEQSSLRGPSTENQEAKKLALECIKLCDPEKLITESKFLQLESLQELMKALIS 1148

  Fly  1091 LLKAPQGHKSIGLPYAEDQTVFWMEFLVKIVVHNRDRMIPLWPAVRDQMYLLLMGSASCGYDYLL 1155
            :....:       .|.|:...|.:|.|::||:.||||:..:|.||||.:|.|.:.:..  :.:|:
 Frog  1149 VTPDEE-------TYDEEDAAFCLEMLMRIVLENRDRVGCVWQAVRDHLYRLCVHAVE--FCFLV 1204

  Fly  1156 NRCIVAVLKLAIYLMRNEELCPIVLQSLKMLLMLKPALLLRISKQISIGIYELLKTSAQNIHSEQ 1220
            .|.:|.:|:|||.|:|.||:...|:.||::|||:||.:|.::|:|::.|::|||||:|.||||..
 Frog  1205 ERAVVGLLRLAIRLLRREEISGQVILSLRILLMMKPTVLSKVSRQVAFGVHELLKTNAANIHSSN 1269

  Fly  1221 DWQIIFNLLECVGAGAVPPNYDDAQLPLPPNGSAKSDGAISGEEDATAVPERGYTSDSEI----- 1280
            ||..:|.||||:|||..||...........:..|:||..:|....:....:||||||||:     
 Frog  1270 DWYTLFCLLECIGAGVKPPPALQVTTRADNDTGAQSDSEVSSYHPSEVNLDRGYTSDSEVYAEHS 1334

  Fly  1281 TKASAAPAVSSPSAEN--WILVNNKDSELTTASRPQSPPSLSAPPVNTLVYNCQL-LDHAPF--- 1339
            .::....:|:.....|  |::|..:|.:.:..:...:.|..:| |||.  |:..: ||..|.   
 Frog  1335 KQSKMHRSVTDVDMMNSGWLMVGKEDVDSSKVATVINKPVANA-PVNQ--YSLTIGLDFGPHDTK 1396

  Fly  1340 ALFKCWDSLAFIVRSVAHITPYNFEACVRCIRIFVEACRDGGI---RQRRKLES---AAKQKSSK 1398
            :|.|..:||:||||..||:||.|||.||:.||:||||..:||:   .|.:::::   .:|....|
 Frog  1397 SLMKSVESLSFIVRDAAHVTPENFELCVKTIRVFVEASLNGGVWYKSQEKRVKNHKYDSKSNRFK 1461

  Fly  1399 KRSERKPGMASSASSSNLTLLTGDPSDNQINGNAAEQED--LAQRYEQLSIQ----LLDLMYTLY 1457
            |:::.|........:||         ..|...::.::||  :...|..:|:|    |||||:||:
 Frog  1462 KKTKEKENSVRRTRASN---------QRQYRSHSDDEEDESVPASYHTVSLQVSHDLLDLMHTLH 1517

  Fly  1458 TRTAQIFRWWAEEGCTVPQSA--------ALWSPGWCPLLQGIARLAMDRRREVRTHAISCLQQR 1514
            ||.|.|:..||||...:..:|        .|||..|||||||||.|..|.||:||..|::.| ||
 Frog  1518 TRAATIYSSWAEEQRNLETAAEKITADSKTLWSNCWCPLLQGIAWLCCDARRQVRMQALTYL-QR 1581

  Fly  1515 ALLVHDLQTLSGTEWCSCFHQVLFPLLNELLPESNAAGQLDAALLEESRIRTATIMSKVFLQHLT 1579
            ||||||||.|...||.|||::||||||.:||...:.|   |...:||:|:|.:|::||||||||:
 Frog  1582 ALLVHDLQALDALEWESCFNKVLFPLLTKLLENISPA---DVGGMEETRMRGSTLLSKVFLQHLS 1643

  Fly  1580 TLIELGNAFNELWLDILDYIERFMKVG-SDTLSEQMQEILKNMLLVMHSVRVFHNQDGSLQQA-L 1642
            .|:.| :.|..|||.|||:::::|..| ||.|.|.:.|.||||||||.:..:||:.|.....: |
 Frog  1644 PLLSL-STFAALWLTILDFMDKYMHAGSSDLLPEAIPESLKNMLLVMDTAGIFHSADSRTGYSDL 1707

  Fly  1643 WELTWRRIGEFLPNLKEELF-----HDEGKRAQTLT----NPAPQAAVAAAPQQQLPAVTILPRQ 1698
            ||:||.||..|||.|:||||     .|......|.|    .|.||:..:..|.:|.|.      .
 Frog  1708 WEITWERIDCFLPRLREELFKQTVIQDPPNIVTTETPVEPRPPPQSTQSERPAEQGPC------D 1766

  Fly  1699 TQVSNELVVSAP---TPPAATPLLGSPVESPRRSIILQPPMADVLQQPPSFVFAQPIIVPPQPPA 1760
            ::..:..:.|||   :..:.||:..|||..      :.||:..           .|:|:.|....
 Frog  1767 SETQSLAISSAPVVGSSSSCTPVRVSPVTD------IPPPITQ-----------SPVILHPLTSP 1814

  Fly  1761 VTDPIPPSTLLPDLVNEATAAAVQATTTSPTHS-PQEAEQPASIVQQTN 1808
            :...:||.: ||.::|   .|.::||:..|..| |:.|:  .|.|.:.|
 Frog  1815 LQVGVPPMS-LPIILN---PALIEATSPVPLLSTPRPAD--VSSVSEVN 1857

Known Domains:


GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 383/754 (51%)
Sec7_N 370..512 CDD:289549 91/142 (64%)
Sec7 643..830 CDD:279680 117/187 (63%)
gbf1XP_012822305.1 COG5307 409..>1158 CDD:227623 390/782 (50%)
Sec7_N 410..555 CDD:289549 94/147 (64%)
Sec7 707..892 CDD:279680 117/187 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87698155
eggNOG 1 0.900 E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37897
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D49474at33208
OrthoFinder 1 1.000 FOG0003012
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.