DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment garz and cyth3a

DIOPT Version :9

Sequence 1:NP_610761.2 Gene:garz / 36337 FlyBaseID:FBgn0264560 Length:1983 Species:Drosophila melanogaster
Sequence 2:XP_001342037.2 Gene:cyth3a / 100002190 ZFINID:ZDB-GENE-120612-1 Length:396 Species:Danio rerio


Alignment Length:204 Identity:69/204 - (33%)
Similarity:123/204 - (60%) Gaps:5/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 ITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIG 696
            :|..:..|..|:.:.::.|.::||..|:||||:|.|:.:|  :..|..:|.||.:..||:|.:||
Zfish    52 LTCVRETKSTQRSKQIAVGRKKFNMDPKKGIQFLLENDLL--QHTPEDIAQFLYKGEGLNKTVIG 114

  Fly   697 EYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQD 761
            :|:.::.:.:.::|..||:..:|..|.:.||||.:|.:|||||||..|..::|.::..:.:.|..
Zfish   115 DYLGERDDFNIRVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAYAARYCQCNPG 179

  Fly   762 PFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIK 826
            .|.:.|..:.|::::||||...||.|.:  :.| ::|.|....||:|.|.|..:|:|..::.:||
Zfish   180 VFQSTDTCYVLSFSVIMLNTSLHNPNVR--DKP-SVERFISMNRGINEGGDLPEELLRNLYESIK 241

  Fly   827 NEEIVMPAE 835
            ||...:|.:
Zfish   242 NEPFKIPED 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
garzNP_610761.2 COG5307 346..>1062 CDD:227623 69/204 (34%)
Sec7_N 370..512 CDD:289549
Sec7 643..830 CDD:279680 65/186 (35%)
cyth3aXP_001342037.2 Sec7 63..245 CDD:279680 65/186 (35%)
PH_GRP1-like 260..379 CDD:269954
PH 264..377 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.