| Sequence 1: | NP_610761.2 | Gene: | garz / 36337 | FlyBaseID: | FBgn0264560 | Length: | 1983 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001342037.2 | Gene: | cyth3a / 100002190 | ZFINID: | ZDB-GENE-120612-1 | Length: | 396 | Species: | Danio rerio |
| Alignment Length: | 204 | Identity: | 69/204 - (33%) |
|---|---|---|---|
| Similarity: | 123/204 - (60%) | Gaps: | 5/204 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 632 ITSEQLAKVKQKKRLLSQGTERFNQRPEKGIQYLQEHGILNAELDPMQVALFLRENPGLDKKMIG 696
Fly 697 EYISKKKNVDSKILINFVDSFDFTGLRVDQALRLYLETFRLPGEAPLIFLVLEHFSDHWHKQNQD 761
Fly 762 PFANVDAAFRLAYAIIMLNMDQHNSNAKRLNVPMTLEDFTKNLRGLNGGEDFDQEMLAQVFNAIK 826
Fly 827 NEEIVMPAE 835 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| garz | NP_610761.2 | COG5307 | 346..>1062 | CDD:227623 | 69/204 (34%) |
| Sec7_N | 370..512 | CDD:289549 | |||
| Sec7 | 643..830 | CDD:279680 | 65/186 (35%) | ||
| cyth3a | XP_001342037.2 | Sec7 | 63..245 | CDD:279680 | 65/186 (35%) |
| PH_GRP1-like | 260..379 | CDD:269954 | |||
| PH | 264..377 | CDD:278594 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170582795 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5307 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||