DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and spint2

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis

Alignment Length:357 Identity:77/358 (22%)
Similarity:112/358 (31%) Gaps:132/358 (37%)


  Fly   524 DGYEMRQ-----------RQYLNPQA------------EFDCQGVH-RMELQETRKCSGRDCLGS 564
            ||||:..           ||.:|...            |..|...| .:.:.|...|....||.|
 Frog    24 DGYEVLDGFCLPEVGTPARQAMNELVSSGNASSEQECWELCCSTEHCDLAVMEEGSCKLIGCLYS 88

  Fly   565 LPGSYSTDMDSPYGGASPGR--IGGNMYGPQLE----PEA---------------------ENFG 602
              |....:::|..|..|..|  ||..   |.|:    |||                     ||| 
 Frog    89 --GFNMCELESKEGTRSYRRKDIGPT---PTLKDFCLPEAVTGPCRAAFERWWYNPNTQTCENF- 147

  Fly   603 DYDDSRNGAVGGFEVGNLKGNIG-----NWALNRQTNLGRDVPSLRPTNYDRARQQAEKSERTTW 662
                    ..||.: |||..:||     |........:..|:  |.|     :::.||.:.....
 Frog   148 --------TYGGCK-GNLNNHIGEEVCMNKCAGVTAEMSNDI--LPP-----SKRMAEANSDPAC 196

  Fly   663 SGQS-----RPDDPRLEDVERAPWHRQRPS---------------NKYGSIVEAPE--MVSPREP 705
            :|:.     |...||        |:....|               |.:.|:.|..:  :||..||
 Frog   197 TGKGVIGNCRASFPR--------WYFDAESQNCISFTYGGCGGTENNHKSVQECADRCIVSKPEP 253

  Fly   706 WQ-RANNFGNPDMYTPGGDVDPSLSYRCFQMVQTAQPRCHDQTITGHFWFYNFCADECMLYAADQ 769
            .: :|...|:...|...    |||:..|....:.              |:|:.....|:.:....
 Frog   254 AKVQAPMTGSFSEYCAA----PSLTGPCRASFRR--------------WYYDVTTATCVAFTYGG 300

  Fly   770 CDRNVNKFRRWEDCEK-CRQPGMAALQQEHTN 800
            |..|.|.:...|||.| |    ...|..:||:
 Frog   301 CRGNKNNYLSVEDCVKNC----AGRLDDDHTS 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081
Spond_N 194..382 CDD:283999
TSP1 425..473 CDD:214559
TSP1 510..561 CDD:214559 12/61 (20%)
spint2NP_001039077.1 MANEC 19..104 CDD:323483 19/82 (23%)
Kunitz_BPTI 118..169 CDD:278443 14/61 (23%)
KU 194..247 CDD:238057 9/61 (15%)
KU 266..318 CDD:238057 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.