DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and Spon1

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_742064.1 Gene:Spon1 RGDID:619918 Length:807 Species:Rattus norvegicus

Alignment Length:890 Identity:234/891 (26%)
Similarity:362/891 (41%) Gaps:228/891 (26%)


  Fly     8 PLVELLLLGSLVIGRV--SSLICTRRPANTGSPKSPVDENFMISVSGNPETYILGQEYNVSLNA- 69
            ||...|......:.:|  |...|:|.....|:.:....| |.:.|.|:|:.|..|..|.|:|:| 
  Rat    22 PLAAALAFSDETLDKVAKSEGYCSRILRAQGTRREGYTE-FSLRVEGDPDFYKPGSSYRVTLSAA 85

  Fly    70 ----FNGHRYISFIMALENENGDFSYNDDLGRFELSDLIETRFSPNCINMVENTNTNSKTHMHLT 130
                |.|   .:.|...||..|| ...|..|.|::.|..||:|..||...|..:....:|.:.:.
  Rat    86 PPSYFRG---FTLIALKENREGD-KEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVF 146

  Fly   131 WVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVP---CCACD 192
            |:|| ..|:|||:::|::.|.|.::..|:|.|||::||:       .||.....|.|   ||||.
  Rat   147 WIAP-PTGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQ-------DPTLDGVTDRPILDCCACG 203

  Fly   193 EARYELIFEGVWSRNLHPKDFPTRG--WETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCS 255
            .|:|.|.|.|.||...||||:|.|.  |..    ::|.:||.:|..||.|..||..:|:.||..|
  Rat   204 TAKYRLTFYGNWSEKTHPKDYPRRANHWSA----IIGGSHSKNYVLWEYGGYASEGVKQVAELGS 264

  Fly   256 SRLLEREFSINFRDQKIRTIIKARG--PSYP--NISSKTMASVRVDPIHHMVSFASKIEPSPDWI 316
            ...:|.|  |..:..::.|:|||:.  ||:.  |:.:...|...||...|::||.:.:.|||||.
  Rat   265 PVKMEEE--IRQQSDEVLTVIKAKAQWPSWQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWN 327

  Fly   317 VGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFY 381
            ||::..:||.:.|.|:::.|.:|.|||.|||||.||.|.::|.:|.:.||.:.|  .:.|:||||
  Rat   328 VGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTS--LDHPQSPFY 390

  Fly   382 DISGTPMKPMAILTVKRQRIYERRC--------------ADEDSNNDPDVPRECFTHPWSSWSDC 432
            |..|..:..:|.:.::|......:|              |.|:.:.| |.|..|....||.||.|
  Rat   391 DPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDED-DTPETCIYSNWSPWSAC 454

  Fly   433 SSK-CGVGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIG 496
            ||. |..|.:.|:|:.| .:|.....|.:.| :.:.|.|..|                       
  Rat   455 SSSTCEKGKRMRQRMLK-AQLDLSVPCPDTQ-DFQPCMGPGC----------------------- 494

  Fly   497 YQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEFDCQG-VHRMELQETRK----- 555
               |.:..:.|.:|.|.:||||||:||.|...|:| |:.   :|...| |..:..:||.|     
  Rat   495 ---SDEDGSTCTMSEWITWSPCSVSCGMGMRSRER-YVK---QFPEDGSVCMLPTEETEKCTVNE 552

  Fly   556 -CSGRDCLGSLPGSYSTDMDSPYGGASPGRIGGNMYGPQLEPEAENFGDYDDSRNGAVGGFEVGN 619
             ||...||                                   ...:|::||.  .|..|     
  Rat   553 ECSPSSCL-----------------------------------VTEWGEWDDC--SATCG----- 575

  Fly   620 LKGNIGNWALNRQTNLGRDVPSLRPTNYDRARQQAEKSERTTWSGQSRPDDPRLEDVERAPWHRQ 684
                :|....:|...:.       |.:....:.:..::|:...        |....:        
  Rat   576 ----MGMKKRHRMVKMS-------PADGSMCKAETSQAEKCMM--------PECHTI-------- 613

  Fly   685 RPSNKYGSIVEAPEMVSPREPWQRANNFGNPDMYTPGGDVDPSLSYRCFQMVQTAQPRCHDQTIT 749
                        |.::||...|.                   ..|..|.:.::|.|.........
  Rat   614 ------------PCLLSPWSEWS-------------------DCSVTCGKGMRTRQRMLKSLAEL 647

  Fly   750 GHFWFYNFC------ADECMLYAADQC--DRNVNKFRRWEDCEK-CRQ----------------- 788
            |.      |      |::|||   .:|  |..::::.:|.:|.| |.:                 
  Rat   648 GD------CNEDLEQAEKCML---PECPIDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGG 703

  Fly   789 -PGMAALQQEHTNSPQCEDFRAIWQAEQRAREEKRPSNRRRNYGD 832
             |....:|::...:.:|....:|.:...|...|.|.|.:.|...|
  Rat   704 APCPETVQRKKCRARKCLRSPSIQKLRWREARESRRSEQLREESD 748

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 47/144 (33%)
Spond_N 194..382 CDD:283999 77/194 (40%)
TSP1 425..473 CDD:214559 17/49 (35%)
TSP1 510..561 CDD:214559 22/58 (38%)
Spon1NP_742064.1 Reeler 43..182 CDD:260081 47/145 (32%)
Spond_N 205..392 CDD:283999 78/195 (40%)
TSP_1 446..494 CDD:278517 17/50 (34%)
TSP_1 505..554 CDD:278517 20/53 (38%)
TSP_1 562..610 CDD:278517 10/74 (14%)
TSP_1 618..665 CDD:278517 13/75 (17%)
TSP_1 672..720 CDD:278517 6/48 (13%)
TSP_1 758..807 CDD:278517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 396 1.000 Inparanoid score I1864
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11311
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.