DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and spon1b

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:XP_005174403.1 Gene:spon1b ZFINID:ZDB-GENE-000427-10 Length:804 Species:Danio rerio

Alignment Length:838 Identity:236/839 (28%)
Similarity:351/839 (42%) Gaps:214/839 (26%)


  Fly    46 FMISVSGNPETYILGQEYNVSLNAFNGHRYISF-IMALENENGDFSYNDDLGRFELSDLIETRFS 109
            |.:.|.|.||||..|..|.|||.|.:...:..| ::||:......|.:|..|.|:|.|..:|:|.
Zfish    58 FRLKVEGEPETYQPGSTYRVSLYASSPSYFRGFTLIALKEGREGVSPDDYAGTFKLIDESDTQFM 122

  Fly   110 PNCINMVENTNTNSKTHMHLTWVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEVTDDV 174
            .||...|..:....:|.:.:.|.||.. |||||.::|:|.|.|.::..|:|.||||:||:....:
Zfish   123 TNCPPAVTESIPRRRTRIQVFWTAPPS-GSGCVTLKASVVQRRIIFFQDEGSLTKRLCEKDPVAI 186

  Fly   175 ESQPTAPAAVDVPCCACDEARYELIFEGVWSRNLHPKDFPTRG--WETRFCELLGAAHSSDYRFW 237
            ..:|..      .||||..|:|.:.|.|.||..|||||:|.|.  |..    |:||:|:..|..|
Zfish   187 TEKPAQ------ECCACGTAKYRVTFYGNWSEKLHPKDYPRRANHWSA----LIGASHTRSYVLW 241

  Fly   238 ESGELASVAMKEYAEHCSSRLLEREFSINFRDQKIRTII--KARGPSYP--NISSKTMASVRVDP 298
            |.|..||..:|:.:|:.|...:|.|  |..:...:.|:|  ||:.|::.  ||.:...|...||.
Zfish   242 EYGGFASEGVKQVSEYGSPVKMEEE--IRQKGDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDR 304

  Fly   299 IHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPD 363
            :.|::||.:.:.|||||.||::|.:||.|:|.|:::.|.:|.|||.|||||.:|.|.::|.:|.:
Zfish   305 VRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSYESPNKPSIPQE 369

  Fly   364 VIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKRQRIYERRC--------------ADEDSNND 414
            .||.:.|  .:.|:|||||.||.||.|:..:.|:|......:|              |.|:....
Zfish   370 RIRPLTS--LDHPQSPFYDPSGGPMTPLGRVVVERIARKGEQCNTVPDTIDDIVADIAQEEKEEG 432

  Fly   415 PDVPRECFTHPWSSWSDCSSK-CGVGMQYRRRVYK---QPELARVYNCNEAQYEERECQGEMCGQ 475
            .:.|..|....||.||.|||. |..|.:.|:|:.|   .|.|.    |...| :...|.|..|  
Zfish   433 DNTPETCIYSNWSPWSACSSSTCDKGRRMRQRMLKAQLDPNLP----CLHTQ-DFEPCMGPGC-- 490

  Fly   476 NNLMREPEEFEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLN--PQA 538
                                    |::..:.|.:|.|.||||||.:||.|...|:| |:.  |:.
Zfish   491 ------------------------SEEEASTCMMSEWISWSPCSASCGMGMRSRER-YVKQFPED 530

  Fly   539 EFDCQGVHRMELQETRKC-SGRDCLGSLPGSYSTDMDSPYGGASPGRIGGNMYGPQLEPEAENFG 602
            ...|    .:..:||.|| ...||                   ||.......:| :.||.:.:.|
Zfish   531 GSSC----TLPTEETEKCVVNDDC-------------------SPSSCVVTEWG-EWEPCSVSCG 571

  Fly   603 DYDDSRNGAVGGFEVGNLKGNIGNWALNRQTNLGRDVPSLRPTNYDRARQQAEKSERTTWSGQSR 667
                                            ||.           |.|::..|.:.:..|    
Zfish   572 --------------------------------LGM-----------RRRERMMKMDASDGS---- 589

  Fly   668 PDDPRLEDVERAPWHRQRPSNKYGSIVEAPEMVSPREPWQRANNFGNPDMYTPGGDVDPSLSYRC 732
            |...::.:.|:.            .:.|...:|....||   :::|             ..|..|
Zfish   590 PCRVQMAEAEKC------------MMPECNAVVCMLSPW---SDWG-------------ECSVSC 626

  Fly   733 FQMVQTAQPRCHDQTITGHFWFYNFCADE------CMLYAADQC--DRNVNKFRRWEDCEKCRQP 789
            ...::|.|.........|.      |.||      |||   .:|  |..::::..|.:|.|....
Zfish   627 GVGMRTRQRMLKTPVKPGQ------CPDELEQVEKCML---PECPTDCMLSEWSAWSECNKSCGK 682

  Fly   790 G------MAALQQEHTNSP-------------QCEDFRAIWQAEQRAREEKRPSNRRR 828
            |      |..|:.:....|             :|.  |....:|:|.|:|  .|:|||
Zfish   683 GHMIRSRMVKLEPQFGGLPCPETVQRKKCKIRKCS--RGSRASEKRKRQE--VSDRRR 736

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 46/122 (38%)
Spond_N 194..382 CDD:283999 78/194 (40%)
TSP1 425..473 CDD:214559 18/52 (35%)
TSP1 510..561 CDD:214559 21/54 (39%)
spon1bXP_005174403.1 Reeler 50..179 CDD:260081 46/122 (38%)
Spond_N 200..387 CDD:283999 79/195 (41%)
TSP_1 442..490 CDD:278517 18/53 (34%)
TSP_1 501..546 CDD:278517 20/50 (40%)
TSP_1 558..606 CDD:278517 13/108 (12%)
TSP_1 614..661 CDD:278517 14/72 (19%)
TSP_1 668..716 CDD:278517 7/48 (15%)
TSP1 756..804 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1891
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 O PTHR11311
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.