DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and fat-spondin

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_477435.1 Gene:fat-spondin FlyBaseID:FBgn0026721 Length:763 Species:Drosophila melanogaster

Alignment Length:859 Identity:252/860 (29%)
Similarity:349/860 (41%) Gaps:227/860 (26%)


  Fly     9 LVELLLLGSLVIGRVSSLICTRRPA--NTGSPKSPVDENFMISVSGNPETYILGQEYNVSLNAFN 71
            |:.|:::..|.|..|::  |.|.|.  |.|. ::..|..:.:.|:..|..|:.|:.||:.|....
  Fly     8 LIRLIVVIWLTISMVTA--CPRAPTHLNHGR-RTRGDNGYKLIVADGPNGYVPGKTYNLLLLGSR 69

  Fly    72 GH----RYISFIMALENENG----DFSYNDDLGRFEL-SDLIETRFSPNCINMVENTNTNSKTHM 127
            .|    .:..|.:..|...|    ..:....:|||:| ||.: |:|:..|:|.|...:...||.:
  Fly    70 THLKVQHFTHFTITAEAHTGARRPQAASPRRVGRFQLFSDSL-TQFNDRCVNTVSEADDLPKTEV 133

  Fly   128 HLTWVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVPCCACD 192
            .:.|||| |.|||||.:.|.|.:....|..|||.|:..|||...|        .||....|||||
  Fly   134 QVMWVAP-ESGSGCVSLSAMVYEGPRAWFADDGNLSTVICERKPD--------AAAAQKECCACD 189

  Fly   193 EARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSR 257
            ||:|..:|||:||...||||:|...|.|.|.:::||:|.|::.||....:|:...:..||..|..
  Fly   190 EAKYSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAGFRSLAEWGSPA 254

  Fly   258 LLEREFSINFRDQKIRTIIKARGPSYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGL 322
            .||.|...|  ..|:||:|||.|..|||::..|.:..|||..|..||..|...|||||:||::||
  Fly   255 ALETELRAN--GPKLRTLIKAAGLWYPNVNQNTSSKFRVDRKHPKVSLVSMFGPSPDWVVGISGL 317

  Fly   323 ELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFYDISGTP 387
            :||..:|:|.|....:|:|||.|||||.:|.|.:....||:.:.|:.:.:|.|||:|||:.....
  Fly   318 DLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQPPERMYRITTMYPEDPRAPFYNPKSRE 382

  Fly   388 MKPMAILTVKRQRIYERRCADE----------DSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQY 442
            |.|:|.|.::|::|..|.|.||          |...:.|...||....:|:||.||..||.|::.
  Fly   383 MTPLAKLYLRREKIVSRNCDDEFLQALQLEVSDDAEEQDTRAECRVGDYSAWSPCSVSCGKGIRM 447

  Fly   443 RRRVYKQPELARVYNC-------------------NEAQYEER---------------------- 466
            |.|.|..|..|....|                   ..||.::|                      
  Fly   448 RSRQYLYPAAADQNKCARQLVAKEMCVAAIPECADGPAQSKDRDDDEGENLANSQSLVGSNGEGA 512

  Fly   467 ------------ECQGEMCG--------------------------QNNLMREPEEFEDLE-PDP 492
                        ||... ||                          :|..||....:|.:| |||
  Fly   513 GLCKTSPWSVWSECSAS-CGIGITMRTRTFVNHLGRKRCPHITIVEKNKCMRPDCTYEQVELPDP 576

  Fly   493 RRIGYQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYL---NPQAEFDCQGVHRMELQETR 554
                         :|..|.|..|||||.|||.|..:|.|..|   .|..| .|  ..||||.:.:
  Fly   577 -------------QCPTSQWSDWSPCSSTCGRGVTIRTRLLLLENGPDKE-SC--TQRMELHQQK 625

  Fly   555 KC-SGRDCLGSLPGSYSTDMDSPYGGASPGRIGGNMYGPQLEPEAENFGDYDDSRNGAVGGFEVG 618
            :| :..||..:...:....:.:|..|...|......|.||               |.....|..|
  Fly   626 ECVNPIDCHINAEQAKDICVQAPDPGPCRGTYMRYAYDPQ---------------NQHCYSFTYG 675

  Fly   619 NLKGNIGNW-----ALNRQTNLGRDVPSLRPTNYDRARQQAEKSERTTWSGQSRPDDPR---LED 675
            ..:||..|:     .||....|                       |:.:|  ||.|.||   |.|
  Fly   676 GCRGNRNNFLTENDCLNTCNVL-----------------------RSPYS--SRVDQPRACVLSD 715

  Fly   676 VERAPWHRQRP-----------SNKYGSIVEAPEMVSPREPWQRANNFGNPDMYTPGGDVDPSLS 729
                 |....|           |.:|  :|..|:            |.|.|            .|
  Fly   716 -----WSVWSPCSVSCGVGVSESRRY--VVTEPQ------------NGGQP------------CS 749

  Fly   730 YRCFQMVQTAQPRC 743
            .|..:....|.|.|
  Fly   750 KRLVKSRSCAMPAC 763

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 48/150 (32%)
Spond_N 194..382 CDD:283999 82/188 (44%)
TSP1 425..473 CDD:214559 19/101 (19%)
TSP1 510..561 CDD:214559 23/55 (42%)
fat-spondinNP_477435.1 Reeler 24..172 CDD:260081 48/153 (31%)
Spond_N 191..378 CDD:283999 82/189 (43%)
TSP1 428..473 CDD:214559 14/45 (31%)
TSP1 518..566 CDD:214559 7/49 (14%)
TSP1 581..627 CDD:214559 21/49 (43%)
Kunitz_BPTI 643..694 CDD:278443 14/66 (21%)
TSP1 714..763 CDD:214559 14/80 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5564
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 P PTHR11311
RoundUp 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.