DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and mspo

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_001286427.1 Gene:mspo FlyBaseID:FBgn0020269 Length:601 Species:Drosophila melanogaster

Alignment Length:665 Identity:141/666 (21%)
Similarity:232/666 (35%) Gaps:204/666 (31%)


  Fly    12 LLLLGSLVIGRVSSLICTRRPANTGSPKSPVDENFMISVSGNPETYILGQEYNVSLNAFNGHRYI 76
            ||.||||                  |.|:.....:..|...||..|    .|:|           
  Fly    18 LLALGSL------------------SSKANAVSAYGASFISNPSIY----AYSV----------- 49

  Fly    77 SFIMALENENGDFSYNDDLGRFELSDLIETRFSPNCINMVENTNTNSKTHMHLTWVAPSEPGSGC 141
                  ||:..:....|:..:|                ..|:.|.||.:::              
  Fly    50 ------ENQPDERESRDNNIKF----------------AAEHGNLNSNSNL-------------- 78

  Fly   142 VLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVPCCACDEAR---YELIFEGV 203
                     :|..::.||......:     :...|..|.||....|...|...|   |:::....
  Fly    79 ---------NRNYYYTDDPSPVSNL-----NPTASLATPPATQPAPQTGCTLDRLAVYKVVLHTY 129

  Fly   204 WSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREF----- 263
            |:|.|.||.:|......::.:.||..|:::|..:..|:.|:.|:|::||...:.||:...     
  Fly   130 WTRELFPKHYPDWRPTAQWTKTLGRTHNANYALYHIGQPATAAVKQFAESGRTDLLDSNAGEQQQ 194

  Fly   264 ----------------------SINFRDQKIRTIIKARG-------------------------- 280
                                  :.:|......|.....|                          
  Fly   195 VQMQLQSQMQAGKSPSGGISSGTTSFNATAASTATPTGGSGGSGGSGGSGGTGTTTAERSVFDEF 259

  Fly   281 --PSYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWD 343
              |:.|..:.::.|.|.||..|.:||..::|.|||||.:||...|||:.. :|::...:.|.|.|
  Fly   260 SMPAIPMGAGRSEAKVFVDSNHSLVSLMTRIVPSPDWFIGVDSFELCVGG-SWIDTVTVELDPLD 323

  Fly   344 VGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFYDISGTPMKPMA---ILTVKRQRIYERR 405
            .|||:|.|:|:.:.|..|..||.|:.|.:|..|...||......:.|:|   .:.:|...:.|..
  Fly   324 AGTDNGFTFTAPNWPTEPQGVIYRITSRYPGHPAGSFYYPKSKRLPPIATFQFIKLKEYELSEVF 388

  Fly   406 CADEDSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQYRRRVYKQPELARVYNCNEAQYEERECQG 470
            ...||......|..:.......:..:.:::....:: |.|..:|.:|.:  |.:|.|....:...
  Fly   389 NIAEDDRKYETVQTQTHLDAEHNHVEMNNELSASIE-RERQTEQQQLQQ--NDDERQRIRSQLLA 450

  Fly   471 EM---CGQNNLM---------------------------REPEEFEDL---EPDPRRIG------ 496
            :|   .|.||.:                           |...:..|.   :|.|..||      
  Fly   451 KMNPIYGSNNSLQPAPGQVVSVVPKNDKHAILQSIASSYRRAADASDANASKPTPSAIGGGKAGG 515

  Fly   497 ---------YQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYL--NPQAEFDCQGVHRMEL 550
                     .:.|.|||.:|.:|.|..|:.||.:||.|...|.|:.:  ..:....|..     |
  Fly   516 AVGGGAATRRRSSAQRRRDCRVSHWSEWTACSKSCGVGEMHRYRKVIKHGKRGGRQCPA-----L 575

  Fly   551 QETRKC-SGRDCLGS 564
            |:::.| :.|:|.||
  Fly   576 QQSKWCGTERNCHGS 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 19/139 (14%)
Spond_N 194..382 CDD:283999 63/246 (26%)
TSP1 425..473 CDD:214559 8/51 (16%)
TSP1 510..561 CDD:214559 15/54 (28%)
mspoNP_001286427.1 Spond_N 120..363 CDD:283999 62/244 (25%)
TSP1 537..588 CDD:214559 16/56 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105293549
eggNOG 1 0.900 E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11311
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.