DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and spon2b

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_571083.4 Gene:spon2b ZFINID:ZDB-GENE-990415-161 Length:331 Species:Danio rerio

Alignment Length:311 Identity:93/312 (30%)
Similarity:142/312 (46%) Gaps:19/312 (6%)


  Fly   178 PTAPAAVDVPCCACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGEL 242
            |..|..||..|.|...|:|.|.|.|.|::...||.:|......::..|:|..|||||..|:..|.
Zfish    24 PAMPVDVDRMCTAPSTAKYRLTFTGQWTQTAFPKHYPLYRPPAQWSPLIGVTHSSDYHLWQRNEY 88

  Fly   243 ASVAMKEYAEHCSSRLLEREF-SINFRDQKIRTIIKARGPSYPNISSKTMASVRVDPIHHMVSFA 306
            ||..::|::|...:..|.:|. :...|.|.:..:..|  |:....:........|...|.::||.
Zfish    89 ASNGVREFSERAEAWTLIKEVEAAGERIQSVYGLFSA--PAVVAGTGHATTEFEVFARHSLLSFI 151

  Fly   307 SKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSD 371
            .:|.|||||.:||..|.|| ....|.|...:.|||:|.|||||.|::|.:...:|.|.:.::.|.
Zfish   152 VRIVPSPDWFIGVDSLNLC-EGDHWKENISLELYPYDAGTDSGFTFSSPNFETIPQDKVTQITSS 215

  Fly   372 FPNDPRSPFYDISGTPMKPMA---ILTVKRQRIYERRCADEDSNNDP----------DVPRECFT 423
            ||:.|.:.||......:.|:|   :..:|..:|:........||..|          :.|.:|..
Zfish   216 FPSHPANSFYYPRLKHLPPIAKVSLTKIKNNQIFSLPIQPTQSNQIPSGNEIDGPLINTPLDCEV 280

  Fly   424 HPWSSWSDCSSKCG-VGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMC 473
            ..||.|..|..:|| .|:::|.|............|...: |:|.|..:.|
Zfish   281 SVWSPWGLCKGQCGEKGVKHRTRYIHTHPANNGAPCPSLE-EKRLCIPDNC 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081
Spond_N 194..382 CDD:283999 64/189 (34%)
TSP1 425..473 CDD:214559 13/49 (27%)
TSP1 510..561 CDD:214559
spon2bNP_571083.4 Spond_N 40..227 CDD:283999 64/190 (34%)
TSP1 280..330 CDD:214559 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.