DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and Spon1

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_663559.1 Gene:Spon1 MGIID:2385287 Length:807 Species:Mus musculus

Alignment Length:890 Identity:232/891 (26%)
Similarity:363/891 (41%) Gaps:228/891 (26%)


  Fly     8 PLVELLLLGSLVIGRV--SSLICTRRPANTGSPKSPVDENFMISVSGNPETYILGQEYNVSLNA- 69
            ||...|......:.:|  |...|:|.....|:.:....| |.:.|.|:|:.|..|..|.|:|:| 
Mouse    22 PLAAALAFSDETLDKVTKSEGYCSRILRAQGTRREGYTE-FSLRVEGDPDFYKPGSSYRVTLSAA 85

  Fly    70 ----FNGHRYISFIMALENENGDFSYNDDLGRFELSDLIETRFSPNCINMVENTNTNSKTHMHLT 130
                |.|   .:.|...||:.|| ...|..|.|::.|..||:|..||...|..:....:|.:.:.
Mouse    86 PPSYFRG---FTLIALKENQEGD-KEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVF 146

  Fly   131 WVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVP---CCACD 192
            |:|| ..|:|||:::|::.|.|.::..|:|.|||::||:       .||.....|.|   ||||.
Mouse   147 WIAP-PTGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQ-------DPTLDGVTDRPILDCCACG 203

  Fly   193 EARYELIFEGVWSRNLHPKDFPTRG--WETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCS 255
            .|:|.|.|.|.||...||||:|.|.  |..    ::|.:||.:|..||.|..||..:|:.||..|
Mouse   204 TAKYRLTFYGNWSEKTHPKDYPRRANHWSA----IIGGSHSKNYVLWEYGGYASEGVKQVAELGS 264

  Fly   256 SRLLEREFSINFRDQKIRTIIKARG--PSYP--NISSKTMASVRVDPIHHMVSFASKIEPSPDWI 316
            ...:|.|  |..:..::.|:|||:.  |::.  |:.:...|...||...|::||.:.:.|||||.
Mouse   265 PVKMEEE--IRQQSDEVLTVIKAKAQWPAWQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWN 327

  Fly   317 VGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFY 381
            ||::..:||.:.|.|:::.|.:|.|||.|||||.||.|.::|.:|.:.||.:.|  .:.|:||||
Mouse   328 VGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTS--LDHPQSPFY 390

  Fly   382 DISGTPMKPMAILTVKRQRIYERRC--------------ADEDSNNDPDVPRECFTHPWSSWSDC 432
            |..|..:..:|.:.::|......:|              |.|:.:.| |.|..|....||.||.|
Mouse   391 DPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDED-DTPETCIYSNWSPWSAC 454

  Fly   433 SSK-CGVGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIG 496
            ||. |..|.:.|:|:.| .:|.....|.:.| :.:.|.|..|                       
Mouse   455 SSSTCEKGKRMRQRMLK-AQLDLSVPCPDTQ-DFQPCMGPGC----------------------- 494

  Fly   497 YQPSQQRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEFDCQG-VHRMELQETRK----- 555
               |.:..:.|.:|.|.:||||||:||.|...|:| |:.   :|...| |..:..:||.|     
Mouse   495 ---SDEDGSTCTMSEWITWSPCSVSCGMGMRSRER-YVK---QFPEDGSVCMLPTEETEKCTVNE 552

  Fly   556 -CSGRDCLGSLPGSYSTDMDSPYGGASPGRIGGNMYGPQLEPEAENFGDYDDSRNGAVGGFEVGN 619
             ||...||                                   ...:|::||.  .|..|     
Mouse   553 ECSPSSCL-----------------------------------VTEWGEWDDC--SATCG----- 575

  Fly   620 LKGNIGNWALNRQTNLGRDVPSLRPTNYDRARQQAEKSERTTWSGQSRPDDPRLEDVERAPWHRQ 684
                :|....:|...:.       |.:....:.:..::|:...        |....:        
Mouse   576 ----MGMKKRHRMVKMS-------PADGSMCKAETSQAEKCMM--------PECHTI-------- 613

  Fly   685 RPSNKYGSIVEAPEMVSPREPWQRANNFGNPDMYTPGGDVDPSLSYRCFQMVQTAQPRCHDQTIT 749
                        |.::||...|.                   ..|..|.:.::|.|.........
Mouse   614 ------------PCLLSPWSEWS-------------------DCSVTCGKGMRTRQRMLKSLAEL 647

  Fly   750 GHFWFYNFC------ADECMLYAADQC--DRNVNKFRRWEDCEK-CRQ----------------- 788
            |.      |      |::|||   .:|  |..::::.:|.:|.| |.:                 
Mouse   648 GD------CNEDLEQAEKCML---PECPIDCELSEWSQWSECNKSCGKGHMIRTRTIQMEPQFGG 703

  Fly   789 -PGMAALQQEHTNSPQCEDFRAIWQAEQRAREEKRPSNRRRNYGD 832
             |....:|::...:.:|....::.:...|...|.|.|.:.|...|
Mouse   704 VPCPETVQRKKCRTRKCLRSPSVQKLRWREARESRRSEQLREESD 748

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 47/144 (33%)
Spond_N 194..382 CDD:283999 76/194 (39%)
TSP1 425..473 CDD:214559 17/49 (35%)
TSP1 510..561 CDD:214559 22/58 (38%)
Spon1NP_663559.1 Reeler 43..182 CDD:260081 47/145 (32%)
Spond_N 205..392 CDD:283999 77/195 (39%)
TSP_1 446..494 CDD:278517 17/50 (34%)
TSP_1 505..554 CDD:278517 20/53 (38%)
TSP_1 562..610 CDD:278517 10/74 (14%)
TSP_1 618..665 CDD:278517 13/75 (17%)
TSP_1 672..720 CDD:278517 6/48 (13%)
TSP_1 758..807 CDD:278517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 396 1.000 Inparanoid score I1944
Isobase 1 0.950 0 Normalized mean entropy S5564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 O PTHR11311
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.780

Return to query results.
Submit another query.