DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and C11H1.5

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_510387.2 Gene:C11H1.5 WormBaseID:WBGene00007530 Length:528 Species:Caenorhabditis elegans

Alignment Length:63 Identity:22/64 (34%)
Similarity:31/64 (48%) Gaps:5/64 (8%)


  Fly   504 RAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQ-AEFDCQG--VHRM--ELQETRKCSGRDC 561
            ::||.:|.||:||.|...|..|..:|.|..|.|. .|...:|  :.|:  .|.||:.|....|
 Worm    19 QSECIVSEWGTWSKCHGGCQKGLIVRNRDVLQPPLQELTSEGRMMQRLCPHLYETKYCDQTTC 81

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081
Spond_N 194..382 CDD:283999
TSP1 425..473 CDD:214559
TSP1 510..561 CDD:214559 19/56 (34%)
C11H1.5NP_510387.2 TSP1 24..81 CDD:214559 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11311
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.