DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and spon-1

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_495473.2 Gene:spon-1 WormBaseID:WBGene00006893 Length:819 Species:Caenorhabditis elegans

Alignment Length:830 Identity:219/831 (26%)
Similarity:351/831 (42%) Gaps:175/831 (21%)


  Fly     9 LVELLLLGSLVIG-RVSSLICTRRPANTGSPKSPVDENFMISVSGN-------PETYILGQEYNV 65
            :::.:||..|:.. ......||.:|......|||....::|.::|.       .:.::.|:.|.|
 Worm     7 ILQFILLLLLIFSCNADEAKCTIKPYEAKGDKSPGSNGYVIEINGTTTKSMDISKGFVPGEIYKV 71

  Fly    66 SLNA----FNGHRYISFIMALENENGDFSYNDDLGRFE-LSDLIETRFSPNCINM-VENTNTNSK 124
            |:..    :....:..|::     :..|..|...|.:: :....:.|.||.|... |.:.|..||
 Worm    72 SIRGWRTQYTVKTFRGFVV-----SSLFEDNTSAGSWQVVKGHGDARISPGCRQSGVSHANLKSK 131

  Fly   125 THMHLTWVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVPCC 189
            |.:|:.|.|| |..||||:.||:|.:.:.:|..:..|||.::|.:....:......|:|.   ||
 Worm   132 TSVHMMWKAP-EVSSGCVVFRASVIETKYIWFTEAEGLTVKLCIQKGTQILKPVDDPSAT---CC 192

  Fly   190 ACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHC 254
            |||.|:|:|.|.|:||:|.||||:||....|.|.::||::|||:|..|..|.:::..|||.||..
 Worm   193 ACDIAQYDLEFTGIWSKNTHPKDYPTLEHLTHFTDMLGSSHSSNYSLWTIGGISTDGMKEIAEWG 257

  Fly   255 SSRLLEREFSINFRDQKIRTIIKARGPSYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGV 319
            ::...|.|  ...:..::|:::|.:|..:|::...|.:...|:..||.||.|:...|||||.||:
 Worm   258 NTYKAEAE--AKAKASEVRSLMKVKGLWFPDVQGTTKSQFVVNKYHHFVSLATMFGPSPDWCVGL 320

  Fly   320 TGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFYDIS 384
            :.:.|||.:|||.||:...|.|:|.||||||||.|.::|..|.:.|..:.:..  :|.||||:..
 Worm   321 SSVNLCLPDCTWAEERTFELQPFDAGTDSGPTYMSPNEPTEPREPIHWITTKL--NPLSPFYNSK 383

  Fly   385 GTPMKPMAILTVKRQRIYERRCADED---------SNNDPDVP----RECFTHPWSSWSDCSSKC 436
            ...:..:|.:.::|:.:....|..:|         :|...|..    |||....|..||.||:.|
 Worm   384 SDTIPTLAKVILRRKNVTSSECKSDDILKAEAHNITNTSEDEEYKDRRECMMTQWEPWSLCSATC 448

  Fly   437 GVGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQPSQ 501
            |.|::.|.|||..|..|:|::|:....|::.|..::    |.....|.|.               
 Worm   449 GKGIRIRSRVYVFPIKAQVFHCHRQTTEKQFCNAKI----NECENSEAFS--------------- 494

  Fly   502 QRRAECELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEF-DCQGVHRMELQETRKC---SGRDCL 562
               ::|::||||||..|||.||.|...|.|.:|||..:. ||.    ::|:....|   :|.|| 
 Worm   495 ---SKCQVSSWGSWGECSVQCGHGMRSRNRTFLNPATKSGDCS----VDLERKDICVGENGDDC- 551

  Fly   563 GSLPGSYSTDMDSPYGGASPGRIGGNMYGPQLEPEAENFGDYDDSRNGAVGGFEVGNLKGNIGNW 627
                            ..:|        .|..:..|  :.|:.........|..|          
 Worm   552 ----------------NVTP--------DPLCKTTA--WSDWSPCSASCDEGVRV---------- 580

  Fly   628 ALNRQTNLGRDVPSLRPTNYDRARQQAEKSERTTWSGQSRPDDPRLEDVERAPWHRQRPSNKYGS 692
                :|.|      ...:.:::........|:.|...||                    ..::..
 Worm   581 ----RTRL------FFYSEHEKRCMHVNLQEKDTCVMQS--------------------CRRFIE 615

  Fly   693 IVEAPEMVSPREPWQRANNFGNPDMYTPGGDVDPSLSYRCFQMVQTAQPRCHDQTITGHFWFYNF 757
            |.........::..|.|.||                            ||         :| ||.
 Worm   616 INSEEICQEDKQAGQCAGNF----------------------------PR---------YW-YNH 642

  Fly   758 CADECMLYAADQCDRNVNKFRRWEDCEKCRQPGMAALQQEHTNSPQCEDF 807
            ...:|..:....|..|.|:|...|:|::...||....:....|:...|||
 Worm   643 EKTQCERFIFTGCKGNRNQFETEEECKQICLPGYEKSKSLIPNNQLLEDF 692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 41/152 (27%)
Spond_N 194..382 CDD:283999 77/188 (41%)
TSP1 425..473 CDD:214559 18/48 (38%)
TSP1 510..561 CDD:214559 23/55 (42%)
spon-1NP_495473.2 Reeler 36..171 CDD:260081 38/141 (27%)
Spond_N 197..381 CDD:283999 77/188 (41%)
TSP1 435..481 CDD:214559 18/46 (39%)
TSP1 499..551 CDD:214559 23/56 (41%)
TSP1 562..610 CDD:214559 10/90 (11%)
Kunitz_BPTI 621..672 CDD:278443 16/89 (18%)
TSP1 708..759 CDD:214559
TSP1 766..816 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5564
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 O PTHR11311
Phylome 1 0.910 0.724 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.730

Return to query results.
Submit another query.