DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and Spon2

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_612542.1 Gene:Spon2 RGDID:708584 Length:330 Species:Rattus norvegicus

Alignment Length:311 Identity:104/312 (33%)
Similarity:152/312 (49%) Gaps:21/312 (7%)


  Fly   177 QPTAPAAVDVPCCACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGE 241
            ||....:|   |.|...|||.:.|.|.||:...||.:|......::..||||||||||..|...|
  Rat    26 QPLGGESV---CTARPLARYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNE 87

  Fly   242 LASVAMKEYAEHCSSRLLEREF-SINFRDQKIRTIIKARGPSYPNISSKTMASVRVDPIHHMVSF 305
            ..|..::::||...:..|.:|. :...:.|.:..:..|  |:.|:.:.:|.|.:.|.|.|.:|||
  Rat    88 YVSNGLRDFAERGEAWALMKEIEAAGEKLQSVHAVFSA--PAVPSGTGQTSAELEVHPRHSLVSF 150

  Fly   306 ASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRS 370
            ..:|.|||||.||:..|:|| ....|.|:.|::|||.|.|||||.|::|.:...:|.|.:..:.:
  Rat   151 VVRIVPSPDWFVGIDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITA 214

  Fly   371 DFPNDPRSPFYDISGTPMKPMAILTVKRQRIYERRCADE------------DSNNDPDVPRECFT 423
            ..|:.|.:.||......:.|:|.:|..|.|...|..|..            ||.:.|:.|.:|..
  Rat   215 SSPSHPANSFYYPRLKSLPPIAKVTFVRLRQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEV 279

  Fly   424 HPWSSWSDCSSKCG-VGMQYRRRVYKQPELARVYNCNEAQYEERECQGEMC 473
            ..||||..|...|| :|.:.|.|..:.........|.|.: ||.||..:.|
  Rat   280 SLWSSWGLCGGPCGKLGAKSRTRYVRVQPANNGTPCPELE-EEAECAPDNC 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081
Spond_N 194..382 CDD:283999 70/189 (37%)
TSP1 425..473 CDD:214559 16/49 (33%)
TSP1 510..561 CDD:214559
Spon2NP_612542.1 Spond_N 40..227 CDD:283999 70/190 (37%)
TSP1 279..329 CDD:214559 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.