DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and LOC100910790

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:XP_008768632.1 Gene:LOC100910790 RGDID:6496621 Length:358 Species:Rattus norvegicus

Alignment Length:258 Identity:87/259 (34%)
Similarity:130/259 (50%) Gaps:19/259 (7%)


  Fly   177 QPTAPAAVDVPCCACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGE 241
            ||....:|   |.|...|||.:.|.|.||:...||.:|......::..||||||||||..|...|
  Rat    26 QPLGGESV---CTARPLARYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNE 87

  Fly   242 LASVAMKEYAEHCSSRLLEREF-SINFRDQKIRTIIKARGPSYPNISSKTMASVRVDPIHHMVSF 305
            ..|..::::||...:..|.:|. :...:.|.:..:..|  |:.|:.:.:|.|.:.|.|.|.:|||
  Rat    88 YVSNGLRDFAERGEAWALMKEIEAAGEKLQSVHAVFSA--PAVPSGTGQTSAELEVHPRHSLVSF 150

  Fly   306 ASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRS 370
            ..:|.|||||.||:..|:|| ....|.|:.|::|||.|.|||||.|::|.:...:|.|.:..:.:
  Rat   151 VVRIVPSPDWFVGIDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITA 214

  Fly   371 DFPNDPRSPFYDISGTPMKPMAILTVKRQRIYERRCADE------------DSNNDPDVPREC 421
            ..|:.|.:.||......:.|:|.:|..|.|...|..|..            ||.:.|:.|.:|
  Rat   215 SSPSHPANSFYYPRLKSLPPIAKVTFVRLRQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDC 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081
Spond_N 194..382 CDD:283999 70/189 (37%)
TSP1 425..473 CDD:214559
TSP1 510..561 CDD:214559
LOC100910790XP_008768632.1 Spond_N 40..227 CDD:283999 70/190 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.