DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG30046 and spon1

Sequence 1:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster
Sequence 2:NP_001090741.1 Gene:spon1 XenbaseID:XB-GENE-991006 Length:803 Species:Xenopus tropicalis

Alignment Length:796 Identity:218/797 (27%)
Similarity:337/797 (42%) Gaps:190/797 (24%)


  Fly    28 CTRRPANTGSPKSPVDENFMISVSGNPETYILGQEYNVSLNA-----FNGHRYISFIMALENENG 87
            |:|.....||.:......|.:.|.|:||.|..|..|.|:|.|     |.|...|:.....|.|..
 Frog    39 CSRILRAQGSTRKEGYNEFSLRVEGDPEFYKPGNTYRVTLLAASPAYFRGFTLIALKEGKEGEKE 103

  Fly    88 DFSYNDDLGRFELSDLIETRFSPNCINMVENTNTNSKTHMHLTWVAPSEP-GSGCVLIRATVQQH 151
            :    |..|.|::.|..:|:|..||...|..:....:|.:.:.|.||  | |||||:::|::.|.
 Frog   104 E----DHAGTFQIIDDEDTQFMSNCPVAVTESTPRRRTRIQVLWTAP--PIGSGCVILKASIVQK 162

  Fly   152 REVWHMDDGGLTKRICE-EVTDDVESQPTAPAAVDVPCCACDEARYELIFEGVWSRNLHPKDFPT 215
            :.::..|:|.||||:|| ::|.:..::...|     .||||..|:|.|.|.|.||...||||:|.
 Frog   163 KIIYFQDEGSLTKRMCEPDLTLEGGNEKPIP-----DCCACGTAKYRLTFYGNWSEKTHPKDYPR 222

  Fly   216 RG--WETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREFSINFRDQKIRTIIKA 278
            |.  |..    ::|.:||.:|..||.|..||..:|:.||..|...:|.|  |..:..::.|:|||
 Frog   223 RANHWSA----IIGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEE--IRQKGDEVLTVIKA 281

  Fly   279 RG--PSYP--NISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINL 339
            :.  |::.  |:.:...|...||...|::||.:.:.|||||.||::..:||.:.|.|:::.:.:|
 Frog   282 KAQWPAWQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDL 346

  Fly   340 YPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVK------- 397
            .|||.|||||.||.|.::|.:|.|.||.:.|  .:.|:|||||..|.|:.|:|.:.::       
 Frog   347 IPWDAGTDSGVTYESPNKPSIPQDKIRPLTS--LDHPQSPFYDPEGGPIIPVARVVIERIARKGD 409

  Fly   398 ----------------------------------------------------RQRIYERR----- 405
                                                                |||:.:.:     
 Frog   410 QCNIVPDNVDDIVPDLVTEEKEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLKAQLDLSV 474

  Fly   406 ---------------CADEDSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQYRRRVYKQ-PELAR 454
                           |:|::::.       |....|.:||.||:.||:||:.|.|..|| ||...
 Frog   475 PCPDTQDFEPCMGPGCSDDEAST-------CMMSEWITWSPCSASCGMGMRSRERYVKQFPEDGS 532

  Fly   455 VYNCNEAQYEE----RECQGEMCGQNNLMREPEEFED--------LEPDPRRIGYQPSQQRRAE- 506
            :......:.|:    .||:...|    ::.|..|:|:        ::...|.|...|:.....: 
 Frog   533 MCKVPTEETEKCIVNEECEPSSC----IVTEWAEWEECSATCGMGMKKRHRMIKMTPADGSMCKA 593

  Fly   507 -----------------CELSSWGSWSPCSVTCGDGYEMRQRQYLNPQAEFDCQGVHRMELQETR 554
                             |.||.|..||.||||||.|...|||...:|....||    ..||::..
 Frog   594 DTTEVEKCMMPECHTIPCVLSPWSEWSDCSVTCGKGTRTRQRMLKSPAELGDC----NEELKQVE 654

  Fly   555 KCSGRDCLGS---LPGSYSTDMDSPYGGASPGRIGGNMYGPQLEPEAENFGDYDDSRNGAVGGFE 616
            ||...:|..|   ...||.::.:...|       .|:|...::......||       |||....
 Frog   655 KCMLPECPISCELTEWSYWSECNKSCG-------KGHMIRTRMITMEPQFG-------GAVCPET 705

  Fly   617 VGNLKGNIGNWALNRQTNLGRDVPSLRPTNYDRARQQAEKSERTTWSGQSRPDDPRLEDVERAPW 681
            |...|..:...    |.:.|.:...|:..   |.::::||::... .|:..|      ..:..||
 Frog   706 VQRKKCRLRKC----QKSSGNERRRLKEA---REKRRSEKTKEDA-DGEQYP------VCKMKPW 756

  Fly   682 HRQRPSNKY--GSIVE 695
            .......|:  |.|.|
 Frog   757 TAWTECTKFCGGGIQE 772

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 47/145 (32%)
Spond_N 194..382 CDD:283999 76/194 (39%)
TSP1 425..473 CDD:214559 18/53 (34%)
TSP1 510..561 CDD:214559 21/51 (41%)
spon1NP_001090741.1 Reeler 38..178 CDD:260081 47/145 (32%)
Spond_N 201..388 CDD:310815 77/195 (39%)
TSP_1 442..490 CDD:306574 3/48 (6%)
TSP_1 501..550 CDD:306574 17/49 (35%)
TSP_1 558..606 CDD:306574 6/48 (13%)
TSP_1 614..661 CDD:306574 21/51 (41%)
TSP_1 668..716 CDD:306574 12/62 (19%)
TSP_1 755..803 CDD:306574 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.780

Return to query results.
Submit another query.