DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17739 and RELN

Sequence 1:NP_610757.1 Gene:CG17739 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_005036.2 Gene:RELN HGNCID:9957 Length:3460 Species:Homo sapiens

Alignment Length:1059 Identity:195/1060 (18%)
Similarity:306/1060 (29%) Gaps:388/1060 (37%)


  Fly    43 LSVNGNTQSYVPGQRYNVSLSA---FSGLSFISFMLALDLESGDGDGDANALGTWEIADLAETRF 104
            |.:.||...|||||.|:|::|.   |.||.......:..:::....|.::|.|   ...:::.:|
Human    59 LHIAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSVQASQSIGGSSAFG---FGIMSDHQF 120

  Fly   105 SPR--CPNLVENTNTNVKTRVDVFWVAPSSPGQGCILLRATVMQHRDVWFMDDGFLTKRMCEE-- 165
            ..:  |..:..:.:....|.:...|:||.: |.||:...||......|.|.|  .|.:::||:  
Human   121 GNQFMCSVVASHVSHLPTTNLSFIWIAPPA-GTGCVNFMATATHRGQVIFKD--ALAQQLCEQGA 182

  Fly   166 -----------EV--------DDIDT------QPSIVDPCCACDEAKY----------------- 188
                       |:        ||.|:      .|:|...|..|:..:.                 
Human   183 PTDVTVHPHLAEIHSDSIILRDDFDSYHQLQLNPNIWVECNNCETGEQCGAIMHGNAVTFCEPYG 247

  Fly   189 --ELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAEHGSTRTL 251
              ||...|..:.......|...|...|||               |.:.:...|  .|::.|...:
Human   248 PRELITTGLNTTTASVLQFSIGSGSCRFS---------------YSDPSIIVL--YAKNNSADWI 295

  Fly   252 ESELKDQSEHIRTII-------KARGIAYPNV----------TGKTFA-------VFRVDSNHHL 292
            :.|......::.|||       .|:|   .||          .|:.:.       :..::|.|..
Human   296 QLEKIRAPSNVSTIIHILYLPEDAKG---ENVQFQWKQENLRVGEVYEACWALDNILIINSAHRQ 357

  Fly   293 ISLVSMVDP--SPDWIV--------------------GVSGLELCLPNC------------SWVE 323
            :.|...:||  :.:|:.                    |..|.|......            .|.|
Human   358 VVLEDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQWSE 422

  Fly   324 NKVHNLYPWD---------AGT-DSGPSYM---SADQPQVPPDVVRRIKSNFPNDPRSPFYDPTG 375
            ........||         .|| :||.|.:   ..::....|.:......|.      .||...|
Human   423 EFESQPTGWDVLGAVIGTECGTIESGLSMVFLKDGERKLCTPSMDTTGYGNL------RFYFVMG 481

  Fly   376 AQMKPLATLHINRRRLYEK----------NCESSDSEQVP--------PECATNSWSRWDECTTK 422
            ....| ...|.|...||.|          :..|..|.:||        ||..|            
Human   482 GICDP-GNSHENDIILYAKIEGRKEHITLDTLSYSSYKVPSLVSVVINPELQT------------ 533

  Fly   423 CGPGKQYRIREFKN-----------------PALAS---------------RHRCNNALREE--- 452
              |..::.:|: ||                 |.|.|               .|:..|::..|   
Human   534 --PATKFCLRQ-KNHQGHNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNSVSLEFST 595

  Fly   453 ----------KNCVGHKCAGFNEETAEGGEPEVAPSPGSSDDPQCGLSDWSEWSSCTVTCGTGEM 507
                      ..|:...|||          |.:..|...|.:      ::|.|:..|:......:
Human   596 NHGRSWSLLHTECLPEICAG----------PHLPHSTVYSSE------NYSGWNRITIPLPNAAL 644

  Fly   508 TRSRH-------------------YLNKKAKKKCQKASRARLHETKICEAMECGGDIENEGGAGE 553
            ||:..                   |:.....|.|....:...|..| |:.           |...
Human   645 TRNTRIRWRQTGPILGNMWAIDNVYIGPSCLKFCSGRGQCTRHGCK-CDP-----------GFSG 697

  Fly   554 PEEEQAG-------GDGGGSAEKRSIFRNFESYSQHREDYIPPVCGVTPWSDFSPCMGPC---GG 608
            |..|.|.       .:..||: :.|.:.||.|.   |...:...|||.       ..|..   ..
Human   698 PACEMASQTFPMFISESFGSS-RLSSYHNFYSI---RGAEVSFGCGVL-------ASGKALVFNK 751

  Fly   609 HGKRQRIRKVWNNNQ---------------VYGVTDPNDDGQDPCRHI--------KLHEE---V 647
            .|:||.|....:::|               :.....|:..|:....|.        ||.|.   :
Human   752 DGRRQLITSFLDSSQSRFLQFTLRLGSKSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYL 816

  Fly   648 NCTNPSCDTI-VPG-----------------------FCYDELTDSPCRDN----DVANF----- 679
            :...|...:: :||                       :..||:..:....|    |..|.     
Human   817 SYHEPRIISVELPGDAKQFGIQFRWWQPYHSSQREDVWAIDEIIMTSVLFNSISLDFTNLVEVTQ 881

  Fly   680 ---WYYDHVSDQCAIYWSDRCDTNRNKFKSKEECEETCRLPRHKQELQHDGIPAIDCLVSDWVSH 741
               :|..:|...|...|: .|.|..:|..|.....||       |.:|   |.|     |..:..
Human   882 SLGFYLGNVQPYCGHDWT-LCFTGDSKLASSMRYVET-------QSMQ---IGA-----SYMIQF 930

  Fly   742 SCNASCGDGFQLRTRRVLRTPKYGGKPCPKHLVRLDRC---YQRCDDMYSISGRGFGE----RRH 799
            |....||..:.......::...........|||: :.|   ...|.:..|.|.....|    ||.
Human   931 SLVMGCGQKYTPHMDNQVKLEYSTNHGLTWHLVQ-EECLPSMPSCQEFTSASIYHASEFTQWRRV 994

  Fly   800 VVRAPQPEPQDECRYSEWS 818
            :|..||.......|: .||
Human   995 IVLLPQKTWSSATRF-RWS 1012

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081 32/125 (26%)
Spond_N 186..373 CDD:283999 43/277 (16%)
TSP1 412..460 CDD:214559 11/93 (12%)
TSP1 490..541 CDD:214559 11/70 (16%)
KU 661..715 CDD:294074 15/66 (23%)
TSP_1 815..862 CDD:278517 2/5 (40%)
RELNNP_005036.2 Reeler 48..178 CDD:260081 32/125 (26%)
Reelin_subrepeat_Nt 202..351 CDD:197344 28/169 (17%)
Reelin_subrepeat_like 421..556 CDD:197448 30/157 (19%)
Reelin_repeat_1_subrepeat_1 526..671 CDD:197345 26/176 (15%)
BNR 1 592..603 1/11 (9%)
EGF_2 <678..700 CDD:285248 6/34 (18%)
Reelin_repeat_1_subrepeat_2 708..862 CDD:197353 27/165 (16%)
BNR 2 798..809 2/11 (18%)
Reelin_repeat_2_subrepeat_1 867..1034 CDD:197346 37/165 (22%)
BNR 3 951..962 1/11 (9%)
EGF_2 1031..1059 CDD:285248
Reelin_repeat_2_subrepeat_2 1065..1220 CDD:197354
BNR 4 1156..1167
Reelin_repeat_3_subrepeat_1 1240..1409 CDD:197347
BNR 5 1322..1333
Reelin_repeat_3_subrepeat_2 1447..1597 CDD:197355
BNR 6 1534..1545
Reelin_repeat_4_subrepeat_1 1605..1774 CDD:197348
BNR 7 1685..1696
EGF_2 <1772..1794 CDD:285248
Reelin_repeat_4_subrepeat_2 1800..1949 CDD:197356
BNR 8 1883..1894
Reelin_repeat_5_subrepeat_1 1956..2130 CDD:197349
BNR 9 2042..2053
EGF_2 2130..2159 CDD:285248
Reelin_repeat_5_subrepeat_2 2165..2314 CDD:197357
BNR 10 2249..2260
Reelin_repeat_6_subrepeat_1 2322..2478 CDD:197350
BNR 11 2398..2409
Reelin_repeat_6_subrepeat_2 2514..2661 CDD:197358
BNR 12 2597..2608
Reelin_repeat_7_subrepeat_1 2669..2853 CDD:197351
BNR 13 2777..2788
EGF_2 2858..2882 CDD:285248
Reelin_repeat_7_subrepeat_2 2889..3050 CDD:197359
BNR 14 2978..2989
Reelin_repeat_8_subrepeat_1 3055..3229 CDD:197352
BNR 15 3142..3154
EGF_2 3234..3258 CDD:285248
Reelin_repeat_8_subrepeat_2 3266..3426 CDD:197360
BNR 16 3362..3373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S10216
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.