DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17739 and CG30046

Sequence 1:NP_610757.1 Gene:CG17739 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_001286341.1 Gene:CG30046 FlyBaseID:FBgn0050046 Length:839 Species:Drosophila melanogaster

Alignment Length:830 Identity:361/831 (43%)
Similarity:478/831 (58%) Gaps:126/831 (15%)


  Fly    11 LALVG--VIPRIEG--CIRVPPGVTAAKSPVDDNYVLSVNGNTQSYVPGQRYNVSLSAFSGLSFI 71
            |.|:|  ||.|:..  |.|.|....:.|||||:|:::||:||.::|:.||.|||||:||:|..:|
  Fly    12 LLLLGSLVIGRVSSLICTRRPANTGSPKSPVDENFMISVSGNPETYILGQEYNVSLNAFNGHRYI 76

  Fly    72 SFMLALDLESGDGDGDANALGTWEIADLAETRFSPRCPNLVENTNTNVKTRVDVFWVAPSSPGQG 136
            ||::||:.|:||...: :.||.:|::||.||||||.|.|:|||||||.||.:.:.|||||.||.|
  Fly    77 SFIMALENENGDFSYN-DDLGRFELSDLIETRFSPNCINMVENTNTNSKTHMHLTWVAPSEPGSG 140

  Fly   137 CILLRATVMQHRDVWFMDDGFLTKRMCEEEVDDIDTQ---PSIVD-PCCACDEAKYELTFEGKWS 197
            |:|:||||.|||:||.||||.||||:|||..||:::|   |:.|| ||||||||:|||.|||.||
  Fly   141 CVLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVPCCACDEARYELIFEGVWS 205

  Fly   198 RHTHPKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAEHGSTRTLESE----LKDQ 258
            |:.||||||...|.|||.:::||:|:.|||||:.|||||..::|.|||.|:|.||.|    .:||
  Fly   206 RNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREFSINFRDQ 270

  Fly   259 SEHIRTIIKARGIAYPNVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVGVSGLELCLPNCSWVE 323
            .  |||||||||.:|||::.||.|..|||..||::|..|.::|||||||||:||||||.||:|:|
  Fly   271 K--IRTIIKARGPSYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWME 333

  Fly   324 NKVHNLYPWDAGTDSGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYDPTGAQMKPLATLHINR 388
            .||.||||||.||||||:|.|:|||||||||:||::|:|||||||||||.:|..|||:|.|.:.|
  Fly   334 EKVINLYPWDVGTDSGPTYTSSDQPQVPPDVIRRMRSDFPNDPRSPFYDISGTPMKPMAILTVKR 398

  Fly   389 RRLYEKNCESSDSE---QVPPECATNSWSRWDECTTKCGPGKQYRIREFKNPALASRHRCNNALR 450
            :|:||:.|...||.   .||.||.|:.||.|.:|::|||.|.|||.|.:|.|.||..:.||.|..
  Fly   399 QRIYERRCADEDSNNDPDVPRECFTHPWSSWSDCSSKCGVGMQYRRRVYKQPELARVYNCNEAQY 463

  Fly   451 EEKNCVGHKCAGFN----EETAEGGEPE---VAPSPGSSDDPQCGLSDWSEWSSCTVTCGTGEMT 508
            ||:.|.|..|...|    .|..|..||:   :...|......:|.||.|..||.|:||||.|...
  Fly   464 EERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTCGDGYEM 528

  Fly   509 RSRHYLNKKAKKKCQKASRARLHETKICEAMECGGDIENE---------GGAG------------ 552
            |.|.|||.:|:..||...|..|.||:.|...:|.|.:...         |||.            
  Fly   529 RQRQYLNPQAEFDCQGVHRMELQETRKCSGRDCLGSLPGSYSTDMDSPYGGASPGRIGGNMYGPQ 593

  Fly   553 -EPEEEQAGG-----DGG-GSAEKRSIFRNFESYSQHREDYIPPVCGVTPWSDFSPCMGPCGGHG 610
             |||.|..|.     :|. |..|..::..|..:::.:|:         |......|.:.|.....
  Fly   594 LEPEAENFGDYDDSRNGAVGGFEVGNLKGNIGNWALNRQ---------TNLGRDVPSLRPTNYDR 649

  Fly   611 KRQRIRK----VWNNNQVYGVTDPNDDGQDPCRHIKLHEE------------------------- 646
            .||:..|    .|:     |.:.|:|...:.......|.:                         
  Fly   650 ARQQAEKSERTTWS-----GQSRPDDPRLEDVERAPWHRQRPSNKYGSIVEAPEMVSPREPWQRA 709

  Fly   647 VNCTNPSCDTIVPG---------FCYDEL-TDSP-CRDNDV-ANFWYYDHVSDQCAIYWSDRCDT 699
            .|..||  |...||         .|:..: |..| |.|..: .:||:|:..:|:|.:|.:|:||.
  Fly   710 NNFGNP--DMYTPGGDVDPSLSYRCFQMVQTAQPRCHDQTITGHFWFYNFCADECMLYAADQCDR 772

  Fly   700 NRNKFKSKEECEETCRLPRHKQELQHDGIPAIDCLVSDWVSHSCNASCGD 749
            |.|||:..|:||: ||.|         |:.|:.      ..|:.:..|.|
  Fly   773 NVNKFRRWEDCEK-CRQP---------GMAALQ------QEHTNSPQCED 806

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081 81/140 (58%)
Spond_N 186..373 CDD:283999 124/191 (65%)
TSP1 412..460 CDD:214559 23/48 (48%)
TSP1 490..541 CDD:214559 23/51 (45%)
KU 661..715 CDD:294074 22/57 (39%)
TSP_1 815..862 CDD:278517
CG30046NP_001286341.1 Reeler 28..167 CDD:260081 81/140 (58%)
Spond_N 194..382 CDD:283999 123/190 (65%)
TSP1 425..473 CDD:214559 23/48 (48%)
TSP1 510..561 CDD:214559 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C315458409
eggNOG 1 0.900 E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1891
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 P PTHR11311
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.