DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17739 and CG30203

Sequence 1:NP_610757.1 Gene:CG17739 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_725128.2 Gene:CG30203 FlyBaseID:FBgn0050203 Length:924 Species:Drosophila melanogaster

Alignment Length:934 Identity:365/935 (39%)
Similarity:498/935 (53%) Gaps:153/935 (16%)


  Fly     9 ILLALVGVIPRIEG-CIRVPPGVTAAKSPVDDNYVLSVNGNTQSYVPGQRYNVSLSAFSGLSFIS 72
            :||.|:.  ..:.| |.|:|.|.:..:||||||:.:.::||.::|||..:||||||....:.|:|
  Fly     6 VLLILLS--SEVRGVCNRIPQGASGPRSPVDDNFKILIDGNPETYVPEHQYNVSLSCPINMKFVS 68

  Fly    73 FMLALDLESGDGD-GDANALGTWEIADLAETRFSPRCPNLVENTNTNVKTRVDVFWVAPSSPGQG 136
            |.|.::.|..... |..:..|.:|:..:.:||||..|.|:|||||||.|..:.|.|:||.:|..|
  Fly    69 FTLVVEAEDPSAAFGGQDMTGHFELLGVGDTRFSTSCENMVENTNTNAKIYIAVSWIAPRNPDSG 133

  Fly   137 CILLRATVMQHRDVWFMDDGFLTKRMCEEEVDDIDTQPSIVDPCCACDEAKYELTFEGKWSRHTH 201
            |:|::|.|:|||||||:||||||||:|.||:|::::....::.||||||||||:..|.||:|:||
  Fly   134 CVLIKAGVVQHRDVWFLDDGFLTKRICPEEIDELNSLTPPLETCCACDEAKYEIVLERKWARNTH 198

  Fly   202 PKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAEHGSTRTLESELKD--QSEHIRT 264
            .||||:..||||..::|||||:..||:|.||..||:|::|:||||:|||||:|:::  |:..:||
  Fly   199 WKDFPSEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIRENTQNGEVRT 263

  Fly   265 IIKARGIAY-PNVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVGVSGLELCLPNCSWVENKVHN 328
            ||||.||.| |...|.|.|..|:|..||.|||.:.:|||||||:||:||||||.||:|:|.||.|
  Fly   264 IIKAPGIPYRPKTFGTTLANARLDPVHHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLN 328

  Fly   329 LYPWDAGTDSGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYDPTGAQMKPLATLHINRRRLYE 393
            |||||.||||||||||:|:|||||||||||.|::|:|.||||||.|||.|||||||::.|::||.
  Fly   329 LYPWDIGTDSGPSYMSSDEPQVPPDVVRRITSSYPSDHRSPFYDDTGAPMKPLATLYLTRKKLYI 393

  Fly   394 KNCESSDSEQVPPECATNSWSRWDECTTKCGPGKQYRIREFKNPALASRHRCNNALREEKNCVGH 458
            :.||....|. |.|||.:.|:.|..|:|:||.|..:|.|.||||.||:...|:..|.|.:.|.|.
  Fly   394 RECEEVPQEG-PLECAVHPWNEWTNCSTRCGQGYSHRQRSFKNPNLAANFNCDRRLEEFRQCQGT 457

  Fly   459 KCAGFNEETAEGGEP----EVAPSPGSSDDPQCGLSDWSEWSSCTVTCGTGEMTRSRHYLNKKAK 519
            :| |..||..||.||    |..||.||.  .:|.|::|.|||.||.|||.|..||:|.|.|.:|:
  Fly   458 QC-GAAEEELEGEEPGLGMENPPSSGSM--AECQLTNWGEWSPCTKTCGRGSSTRTRDYYNPQAR 519

  Fly   520 KKCQKASRARLHETKICEAMECGGDIENEGGA-GEPEEEQAG-GDGGGSAEKRSIFRNFESYSQ- 581
            ::|....|..|.||:.|...:|||.|.:.|.. |.||.:..| .|.||...|.:.:.:.:.:|. 
  Fly   520 QRCLSVMRIPLEETRECIGSDCGGTIPDNGELDGFPEPDVFGETDHGGYMGKTTSWNSKQEHSSL 584

  Fly   582 -------HREDYIPPVCGVTPWSDFS------------------------PCMGP---CGGHGK- 611
                   :|:.|       ..|.|.|                        |...|   .||:.| 
  Fly   585 GSGNQAWNRKPY-------NSWKDKSLSNPRDNAQESPNLPFDQIENPQRPAYNPSDNMGGYDKG 642

  Fly   612 ------------------RQRIRKVWNNNQVYG-VTDPNDDGQDP--CRHIKLHEEV----NCTN 651
                              .......:||...|. .|.|:...:.|  .|:....|.|    |..|
  Fly   643 FPPTNSYSNDKLVGNRPGYNDFNSDYNNKDAYNDYTTPSFTSRTPFGSRYPNQQETVEGNTNDIN 707

  Fly   652 PSCDTIVPGFCYDE--LTDSPCRDNDV--ANFWYYDHVSDQCAIYWSDRCDTNRNKFKSKEECEE 712
            .:.: :|..:|:::  .:..||....|  :|:|:|||...:|.|:.:|.||.|||:|::...||.
  Fly   708 GNYN-VVQDYCFEKPYASTLPCFAKPVVESNYWFYDHEDHECKIFTTDNCDQNRNRFRTLTACEG 771

  Fly   713 TCRLP-----------------RHKQELQHDGIPAIDCLVSDWVS---------HSCNASCGDGF 751
            ||..|                 |...:.|..|.|      .|..|         .|.:...|..:
  Fly   772 TCLQPQINMERSENDAMDLYGRRSYDQKQTRGRP------YDQTSGIAYGQTEGRSYDQKVGKSY 830

  Fly   752 QLRTRRVLRTPKYGGKPCPKHLVRLDRCY---------QRCDDMYSIS----------------- 790
            .....|..:....|....|:     ||.|         |..|..|.:|                 
  Fly   831 DRTFGRSYKQTGGGSYDQPE-----DRSYDLSTGRSYVQPEDRSYDLSRGRSYDQPVGRSYDLAG 890

  Fly   791 GRGFGERRHVVRAPQPEPQDECRY 814
            ||.:||........:|..|...||
  Fly   891 GRSYGETSEAGDIGEPMSQTRSRY 914

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081 68/141 (48%)
Spond_N 186..373 CDD:283999 121/190 (64%)
TSP1 412..460 CDD:214559 20/48 (42%)
TSP1 490..541 CDD:214559 22/51 (43%)
KU 661..715 CDD:294074 22/58 (38%)
TSP_1 815..862 CDD:278517 365/935 (39%)
CG30203NP_725128.2 Reeler 18..160 CDD:260081 68/142 (48%)
Spond_N 183..372 CDD:283999 120/189 (63%)
TSP1 411..459 CDD:214559 20/48 (42%)
TSP1 492..541 CDD:214559 22/49 (45%)
KU <739..773 CDD:197529 16/34 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C315458438
eggNOG 1 0.900 E1_KOG3539
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 393 1.000 Inparanoid score I1891
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 P PTHR11311
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.