DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17739 and Spon1

Sequence 1:NP_610757.1 Gene:CG17739 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_663559.1 Gene:Spon1 MGIID:2385287 Length:807 Species:Mus musculus

Alignment Length:898 Identity:287/899 (32%)
Similarity:420/899 (47%) Gaps:179/899 (20%)


  Fly    17 IPRIEG-CIRVPPGVTAAKSPVDDNYV---LSVNGNTQSYVPGQRYNVSLSAFSGLSFISFMLAL 77
            :.:.|| |.|    :..|:....:.|.   |.|.|:...|.||..|.|:|||.....|..|.|..
Mouse    37 VTKSEGYCSR----ILRAQGTRREGYTEFSLRVEGDPDFYKPGSSYRVTLSAAPPSYFRGFTLIA 97

  Fly    78 DLESGDGDGDANALGTWEIADLAETRFSPRCPNLVENTNTNVKTRVDVFWVAPSSPGQGCILLRA 142
            ..|:.:||.:.:..||::|.|..||:|...||..|..:....:||:.|||:||.: |.||::|:|
Mouse    98 LKENQEGDKEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQVFWIAPPT-GTGCVILKA 161

  Fly   143 TVMQHRDVWFMDDGFLTKRMCEEE--VDDIDTQPSIVDPCCACDEAKYELTFEGKWSRHTHPKDF 205
            :::|.|.::|.|:|.|||::||::  :|.:..:| |:| ||||..|||.|||.|.||..|||||:
Mouse   162 SIVQKRIIYFQDEGSLTKKLCEQDPTLDGVTDRP-ILD-CCACGTAKYRLTFYGNWSEKTHPKDY 224

  Fly   206 P--ANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAEHGSTRTLESELKDQSEHIRTIIKA 268
            |  ||.|    |.|||.||:.:|..|:||..||||:::|||.||...:|.|::.||:.:.|:|||
Mouse   225 PRRANHW----SAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKA 285

  Fly   269 RGIAYP-----NVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVGVSGLELCLPNCSWVENKVHN 328
            :. .:|     ||.....|.|.||...||:|.::|:.|||||.||:|..:||...|.||:..|.:
Mouse   286 KA-QWPAWQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQD 349

  Fly   329 LYPWDAGTDSGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYDPTGAQMKPLATLHINRRRLYE 393
            |.|||||||||.:|.|.::|.:|.:.:|.:.|  .:.|:||||||.|..:..:|.:.|.|.....
Mouse   350 LIPWDAGTDSGVTYESPNKPTIPQEKIRPLTS--LDHPQSPFYDPEGGSITQVARVVIERIARKG 412

  Fly   394 KNC----------------ESSDSEQVPPECATNSWSRWDECTTK-CGPGKQYRIREFKNPALAS 441
            :.|                |..|.:..|..|..::||.|..|::. |..||:.|.|..| ..|..
Mouse   413 EQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLK-AQLDL 476

  Fly   442 RHRCNNALREEKNCVGHKCAGFNEETAEGGEPEVAPSPGSSDD--PQCGLSDWSEWSSCTVTCGT 504
            ...|.:. ::.:.|:|                     ||.||:  ..|.:|:|..||.|:|:||.
Mouse   477 SVPCPDT-QDFQPCMG---------------------PGCSDEDGSTCTMSEWITWSPCSVSCGM 519

  Fly   505 GEMTRSRHYLNKKAKKKCQKASRARLHETKICEAMECGGDIENEGGAGEPEEEQAGGDGGGSAEK 569
            |..:|.|:     .|:..:..|...|                       |.||         .||
Mouse   520 GMRSRERY-----VKQFPEDGSVCML-----------------------PTEE---------TEK 547

  Fly   570 RSIFRNFESYSQHREDYIPPVCGVTPWSDFSPCMGPCG-GHGKRQRIRKVWNNNQVYGVTDPNDD 633
            .::          .|:..|..|.||.|.::..|...|| |..||.|:.|:          .|.|.
Mouse   548 CTV----------NEECSPSSCLVTEWGEWDDCSATCGMGMKKRHRMVKM----------SPADG 592

  Fly   634 GQDPCRHIKLHEEVNCTNPSCDTIVPGFCYDELTDSPCRDNDVANFWYYDHVSDQCAIYWSDRCD 698
            ..  |: .:..:...|..|.|.||            ||    :.:.|  ...|| |::.......
Mouse   593 SM--CK-AETSQAEKCMMPECHTI------------PC----LLSPW--SEWSD-CSVTCGKGMR 635

  Fly   699 TNRNKFKS-------KEECE--ETCRLPRHKQELQHDGIPAIDCLVSDWVSHS-CNASCGDGFQL 753
            |.:...||       .|:.|  |.|.||.         .| |||.:|:|...| ||.|||.|..:
Mouse   636 TRQRMLKSLAELGDCNEDLEQAEKCMLPE---------CP-IDCELSEWSQWSECNKSCGKGHMI 690

  Fly   754 RTRRVLRTPKYGGKPCPKHLVRLDRCYQRCDDMYSISGRGFGERRHVVRAPQPEPQDE------C 812
            |||.:...|::||.|||:.:.|.....::|....|:....:.|.|...|:.|...:.:      |
Mouse   691 RTRTIQMEPQFGGVPCPETVQRKKCRTRKCLRSPSVQKLRWREARESRRSEQLREESDGEQFPGC 755

  Fly   813 RYSEWSAWTPCTATCGDNAVRQRTRTLMNTDLSYK---CKDRVRMEKCVMMPC 862
            |...|:||:.||..|| ..:::|..|:.....|.:   |||:..:..|.:.||
Mouse   756 RMRPWTAWSECTKLCG-GGIQERYMTVKKRFKSSQFTSCKDKKEIRACNVHPC 807

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081 51/143 (36%)
Spond_N 186..373 CDD:283999 92/194 (47%)
TSP1 412..460 CDD:214559 14/49 (29%)
TSP1 490..541 CDD:214559 14/51 (27%)
KU 661..715 CDD:294074 13/63 (21%)
TSP_1 815..862 CDD:278517 15/50 (30%)
Spon1NP_663559.1 Reeler 43..182 CDD:260081 51/144 (35%)
Spond_N 205..392 CDD:283999 92/194 (47%)
TSP_1 446..494 CDD:278517 16/71 (23%)
TSP_1 505..554 CDD:278517 20/96 (21%)
TSP_1 562..610 CDD:278517 15/61 (25%)
TSP_1 618..665 CDD:278517 13/59 (22%)
TSP_1 672..720 CDD:278517 19/48 (40%)
TSP_1 758..807 CDD:278517 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C315450042
eggNOG 1 0.900 E1_KOG3539
Hieranoid 1 1.000
Homologene 1 1.000 H4453
Inparanoid 1 1.050 396 1.000 Inparanoid score I1944
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D240419at33208
OrthoFinder 1 1.000 FOG0003736
OrthoInspector 1 1.000 T616029
orthoMCL 1 0.900 OOG5_132084
Panther 1 1.100 LDO PTHR11311
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3762
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.