DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17739 and Spon2

Sequence 1:NP_610757.1 Gene:CG17739 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_612542.1 Gene:Spon2 RGDID:708584 Length:330 Species:Rattus norvegicus

Alignment Length:304 Identity:104/305 (34%)
Similarity:145/305 (48%) Gaps:31/305 (10%)


  Fly   180 CCACDEAKYELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAE 244
            |.|...|:|.:||.||||:...||.:|......::|.::||:|:.||..|:..|..|.|||:.||
  Rat    34 CTARPLARYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAE 98

  Fly   245 HGSTRTLESELKDQSEHIRTIIKA-RGIAYPNVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVG 308
            .|....|..|::...|.::::... ...|.|:.||:|.|...|...|.|:|.|..:.|||||.||
  Rat    99 RGEAWALMKEIEAAGEKLQSVHAVFSAPAVPSGTGQTSAELEVHPRHSLVSFVVRIVPSPDWFVG 163

  Fly   309 VSGLELCLPNCSWVENKVHNLYPWDAGTDSGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYDP 373
            :..|:|| ....|.|..|.:|||.|||||||.::.|.:...:|.|.|..|.::.|:.|.:.||.|
  Rat   164 IDSLDLC-EGGRWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFYYP 227

  Fly   374 TGAQMKPLATLHINRRR------------LYEKNCESSDSEQVPP---ECATNSWSRWDECTTKC 423
            ....:.|:|.:...|.|            |..:..|..||..||.   :|..:.||.|..|...|
  Rat   228 RLKSLPPIAKVTFVRLRQSPRAFAPPSLDLASRGNEIVDSLSVPETPLDCEVSLWSSWGLCGGPC 292

  Fly   424 GP-GKQYRIREFK-NPALASRHRCNNA-----LREEKNCVGHKC 460
            |. |.:.|.|..: .||       ||.     |.||..|....|
  Rat   293 GKLGAKSRTRYVRVQPA-------NNGTPCPELEEEAECAPDNC 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081
Spond_N 186..373 CDD:283999 72/188 (38%)
TSP1 412..460 CDD:214559 17/55 (31%)
TSP1 490..541 CDD:214559
KU 661..715 CDD:294074
TSP_1 815..862 CDD:278517
Spon2NP_612542.1 Spond_N 40..227 CDD:283999 72/188 (38%)
TSP1 279..329 CDD:214559 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.