DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17739 and SPON2

Sequence 1:NP_610757.1 Gene:CG17739 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_001121797.1 Gene:SPON2 HGNCID:11253 Length:331 Species:Homo sapiens

Alignment Length:304 Identity:106/305 (35%)
Similarity:148/305 (49%) Gaps:31/305 (10%)


  Fly   180 CCACDEAKYELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAE 244
            |.|...|||.:||.||||:...||.:|......::|.::||:|:.||..|:..:..|.|||:.||
Human    35 CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAE 99

  Fly   245 HGSTRTLESELKDQSEHIRTIIKA-RGIAYPNVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVG 308
            .|....|..|::...|.::::... ...|.|:.||:|.|...|...|.|:|.|..:.|||||.||
Human   100 RGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVG 164

  Fly   309 VSGLELCLPNCSWVENKVHNLYPWDAGTDSGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYDP 373
            |..|:|| ....|.|....:|||:|||||||.::.|.:...:|.|.|..|.|:.|:.|.:.||.|
Human   165 VDSLDLC-DGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYP 228

  Fly   374 TGAQMKPLATLHINRRR------------LYEKNCESSDSEQVPP---ECATNSWSRWDECTTKC 423
            ....:.|:|.:.:.|.|            |..::.|..||..||.   :|..:.||.|..|...|
Human   229 RLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHC 293

  Fly   424 GP-GKQYRIREFK-NPALASRHRCNNA-----LREEKNCVGHKC 460
            |. |.:.|.|..: .||       ||.     |.||..||...|
Human   294 GRLGTKSRTRYVRVQPA-------NNGSPCPELEEEAECVPDNC 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081
Spond_N 186..373 CDD:283999 73/188 (39%)
TSP1 412..460 CDD:214559 18/55 (33%)
TSP1 490..541 CDD:214559
KU 661..715 CDD:294074
TSP_1 815..862 CDD:278517
SPON2NP_001121797.1 Spond_N 41..228 CDD:283999 73/188 (39%)
TSP1 280..330 CDD:214559 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3762
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.