DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17739 and spon1

Sequence 1:NP_610757.1 Gene:CG17739 FlyBaseID:FBgn0033710 Length:873 Species:Drosophila melanogaster
Sequence 2:NP_001090741.1 Gene:spon1 XenbaseID:XB-GENE-991006 Length:803 Species:Xenopus tropicalis

Alignment Length:889 Identity:274/890 (31%)
Similarity:401/890 (45%) Gaps:168/890 (19%)


  Fly    21 EG-CIRVPPGVTAAKSPVDDNYVLSVNGNTQSYVPGQRYNVSLSAFSGLSFISFMLALDLESGDG 84
            || |.|:.....:.:....:.:.|.|.|:.:.|.||..|.|:|.|.|...|..|.|....|..:|
 Frog    36 EGYCSRILRAQGSTRKEGYNEFSLRVEGDPEFYKPGNTYRVTLLAASPAYFRGFTLIALKEGKEG 100

  Fly    85 DGDANALGTWEIADLAETRFSPRCPNLVENTNTNVKTRVDVFWVAPSSPGQGCILLRATVMQHRD 149
            :.:.:..||::|.|..:|:|...||..|..:....:||:.|.|.||.. |.||::|:|:::|.:.
 Frog   101 EKEEDHAGTFQIIDDEDTQFMSNCPVAVTESTPRRRTRIQVLWTAPPI-GSGCVILKASIVQKKI 164

  Fly   150 VWFMDDGFLTKRMCEEEVDDIDTQPSIVDPCCACDEAKYELTFEGKWSRHTHPKDFP--ANSWRT 212
            ::|.|:|.|||||||.::.........:..||||..|||.|||.|.||..|||||:|  ||.|  
 Frog   165 IYFQDEGSLTKRMCEPDLTLEGGNEKPIPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHW-- 227

  Fly   213 RFSDIIGASHTLDYRFWQYGELASEGLREVAEHGSTRTLESELKDQSEHIRTIIKARGIAYP--- 274
              |.|||.||:.:|..|:||..||:|:::|||.||...:|.|::.:.:.:.|:|||:. .:|   
 Frog   228 --SAIIGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKA-QWPAWQ 289

  Fly   275 --NVTGKTFAVFRVDSNHHLISLVSMVDPSPDWIVGVSGLELCLPNCSWVENKVHNLYPWDAGTD 337
              ||.....|.|.||.:.||:|.::|:.|||||.||:|..:||...|.||:..:.:|.|||||||
 Frog   290 PLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTD 354

  Fly   338 SGPSYMSADQPQVPPDVVRRIKSNFPNDPRSPFYDPTGAQMKPLATLHINRRRLYEKNC------ 396
            ||.:|.|.::|.:|.|.:|.:.|  .:.|:||||||.|..:.|:|.:.|.|.......|      
 Frog   355 SGVTYESPNKPSIPQDKIRPLTS--LDHPQSPFYDPEGGPIIPVARVVIERIARKGDQCNIVPDN 417

  Fly   397 ----------ESSDSEQVPPECATNSWSRWDECTT-KCGPGKQYRIREFKNPALASRHRCNNALR 450
                      |..:.:..|..|..::||.|..|:: .|..||:.|.|..| ..|.....|.:. :
 Frog   418 VDDIVPDLVTEEKEEDDTPETCIYSNWSPWSACSSATCDKGKRMRQRMLK-AQLDLSVPCPDT-Q 480

  Fly   451 EEKNCVGHKCAGFNEETAEGGEPEVAPSPGSSDD--PQCGLSDWSEWSSCTVTCGTGEMTRSRHY 513
            :.:.|:|                     ||.|||  ..|.:|:|..||.|:.:||.|..:|.|: 
 Frog   481 DFEPCMG---------------------PGCSDDEASTCMMSEWITWSPCSASCGMGMRSRERY- 523

  Fly   514 LNKKAKKKCQKASRARLHETKICEAMECGGDIENEGGAGEPEEEQAGGDGGGSAEKRSIFRNFES 578
                .|:..:..|..::                       |.||         .||..:      
 Frog   524 ----VKQFPEDGSMCKV-----------------------PTEE---------TEKCIV------ 546

  Fly   579 YSQHREDYIPPVCGVTPWSDFSPCMGPCG-GHGKRQRIRKVWNNNQVYGVTDPNDDGQDPCRHIK 642
                .|:..|..|.||.|:::..|...|| |..||.|:.|:          .|.|...  |: ..
 Frog   547 ----NEECEPSSCIVTEWAEWEECSATCGMGMKKRHRMIKM----------TPADGSM--CK-AD 594

  Fly   643 LHEEVNCTNPSCDTIVPGFCYDELTDSPCRDNDVANFWYYDHVSDQCAIYWSDRCDTNRNKFKSK 707
            ..|...|..|.|.||            ||    |.:.|  ...|| |::.......|.:...||.
 Frog   595 TTEVEKCMMPECHTI------------PC----VLSPW--SEWSD-CSVTCGKGTRTRQRMLKSP 640

  Fly   708 EE---CE------ETCRLPRHKQELQHDGIPAIDCLVSDWVSHS-CNASCGDGFQLRTRRVLRTP 762
            .|   |.      |.|.||.         .| |.|.:::|...| ||.|||.|..:|||.:...|
 Frog   641 AELGDCNEELKQVEKCMLPE---------CP-ISCELTEWSYWSECNKSCGKGHMIRTRMITMEP 695

  Fly   763 KYGGKPCPKHLVRLDRCYQRCDDMYSISGRGFGERRHVVRAPQP------EPQDECRYSEWSAWT 821
            ::||..||:.:.|.....::|........|...|.|...|:.:.      |....|:...|:|||
 Frog   696 QFGGAVCPETVQRKKCRLRKCQKSSGNERRRLKEAREKRRSEKTKEDADGEQYPVCKMKPWTAWT 760

  Fly   822 PCTATCGDNAVRQRTRTLMNTDLSYK---CKDRVRMEKCVMMPC 862
            .||..|| ..:::|..|:.....|.:   |||:..:..|.:.||
 Frog   761 ECTKFCG-GGIQERFMTVKKRFKSSQFTSCKDKKEIRACNVHPC 803

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17739NP_610757.1 Reeler 23..163 CDD:260081 47/140 (34%)
Spond_N 186..373 CDD:283999 89/194 (46%)
TSP1 412..460 CDD:214559 14/49 (29%)
TSP1 490..541 CDD:214559 12/51 (24%)
KU 661..715 CDD:294074 14/63 (22%)
TSP_1 815..862 CDD:278517 16/50 (32%)
spon1NP_001090741.1 Reeler 38..178 CDD:260081 47/141 (33%)
Spond_N 201..388 CDD:310815 89/194 (46%)
TSP_1 442..490 CDD:306574 16/71 (23%)
TSP_1 501..550 CDD:306574 18/96 (19%)
TSP_1 558..606 CDD:306574 16/61 (26%)
TSP_1 614..661 CDD:306574 13/59 (22%)
TSP_1 668..716 CDD:306574 17/48 (35%)
TSP_1 755..803 CDD:306574 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C315451003
eggNOG 1 0.900 E1_KOG3539
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4453
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D240419at33208
OrthoFinder 1 1.000 FOG0003736
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.