DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and Slc6a11

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_077348.1 Gene:Slc6a11 RGDID:628737 Length:627 Species:Rattus norvegicus

Alignment Length:558 Identity:208/559 (37%)
Similarity:315/559 (56%) Gaps:17/559 (3%)


  Fly    48 EAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYY 112
            ||..::..:|..|:..|||:.|.....:|||||||||::..:|||||||||||:..:..|.||::
  Rat    36 EARDKAVHERGHWNNKVEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFF 100

  Fly   113 LEVIIGQFSSRGCIRAF-DMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTY 176
            ||..:|||:|.|.|..: .:.|:..||.|......|....||..|:|..|.||...|:..|||..
  Rat   101 LETALGQFTSEGGITCWRRVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWAT 165

  Fly   177 CLVEWG-KSCVA-TGATAANDSSI-VQGVSSAEL-FFTQTVLREPESLDDNGLGTPSWDLVLCLL 237
            |..||. :.||. .....:|.|.: :|..:|..: |:.:.||...:.::.  :|...|:|.||||
  Rat   166 CGHEWNTEKCVEFQKLNFSNYSHVSLQNATSPVMEFWERRVLAISDGIEH--IGNLRWELALCLL 228

  Fly   238 ATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHV 302
            |.|.|....:.||.:|:||..|..|.|||:::::||||.||||||.:||.::|.|..|:|.:|.|
  Rat   229 AAWTICYFCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQV 293

  Fly   303 WYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFET 367
            |..|.||:|||.|||.|.|....|:|::|.|.::|.|::..::|.||.:||..||.:||.:|:|.
  Rat   294 WVDAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQ 358

  Fly   368 NTKDISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRF 432
            .. .|::|.:.|.|||||:||:|:......| |:|.|||.||:.||:.|......::|..|.|.:
  Rat   359 GV-PIAEVAESGPGLAFIAYPKAVTMMPLSP-LWATLFFMMLIFLGLDSQFVCVESLVTAVVDMY 421

  Fly   433 THL-----PHWLLAVSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALV-LAIAELLAVGWIY 491
            ..:     ...||.::.||:.:..|||.:|.||.::..|.|.|..:.:.|: :||.|.:.:||:|
  Rat   422 PKVFRRGYRRELLILALSIVSYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECVCIGWVY 486

  Fly   492 GVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGV-QYPPVYYMAGWI 555
            |..|...:||.|:..:.....:.||.:|.||:...:.::.|..|:||.|..| .||...|..||:
  Rat   487 GSNRFYDNIEDMIGYRPLSLIKWCWKVVTPGICAGIFIFFLVKYKPLKYNNVYTYPAWGYGIGWL 551

  Fly   556 IWGLGVLQLPFWALVTIYQQPGKTFGSKFGLAMQPTAN 593
            :....:|.:|.|..:.:::..| |...|......|:|:
  Rat   552 MALSSMLCIPLWIFIKLWKTEG-TLPEKLQKLTVPSAD 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 186/485 (38%)
Slc6a11NP_077348.1 SLC6sbd_GAT3 44..585 CDD:212077 204/546 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107207384
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.