DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and Slc6a1

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_077347.1 Gene:Slc6a1 RGDID:620533 Length:599 Species:Rattus norvegicus

Alignment Length:608 Identity:197/609 (32%)
Similarity:317/609 (52%) Gaps:48/609 (8%)


  Fly    29 DG-ISTVIYSA-----EGEELTINCEAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIA 87
            || |||.:..|     :.:.|.:..:.::.....||.|....:||.||:..::|||||||||::.
  Rat    10 DGQISTEVSEAPVASDKPKTLVVKVQKKAGDLPDRDTWKGRFDFLMSCVGYAIGLGNVWRFPYLC 74

  Fly    88 LENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALATTY 152
            .:||||||||||.:.|:..|.|::.||..:||::|.|.:..:.:||:.:|:.......:.....|
  Rat    75 GKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIY 139

  Fly   153 YACIMALTIRYLVASFSEVLPWTYCLVEWGKSCVATGATAANDSSIVQGVSSAELFFTQTVLREP 217
            |..|::..|.||..||:..|||..|...|......:..:..|.:::...|..   |:.:.:.:..
  Rat   140 YIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSLVNTTNMTSAVVE---FWERNMHQMT 201

  Fly   218 ESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGA 282
            :.||..  |...|.|.:.|...||::...:.||:..:||..||.|.:||:::|:|..|.||||||
  Rat   202 DGLDKP--GQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGA 264

  Fly   283 WQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSL 347
            .:||::::.|.:.:|.:..||..|.||:|||..:..|:|:...|:|.|:.||::|.||:..|:|.
  Rat   265 KEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSC 329

  Fly   348 TSILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVL 412
            ||:.||.:||.|:|.:|..|. :.|:.|...|.||||::||||:.:....| |:|:|||.|||:|
  Rat   330 TSMFAGFVIFSIVGFMAHVTK-RSIADVAASGPGLAFLAYPEAVTQLPISP-LWAILFFSMLLML 392

  Fly   413 GIGSNIGMASAVVNVVKDRFTHL---PHWLLAVSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTF 474
            ||.|........:..:.|.:..|   ...|...:..|:.:|.||..:|.||.:|..|.|:|..:.
  Rat   393 GIDSQFCTVEGFITALVDEYPRLLRNRRELFIAAVCIVSYLIGLSNITQGGIYVFKLFDYYSASG 457

  Fly   475 IALV-LAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPL 538
            ::|: |...|.:::.|.|||.|...:|:.|:..:...:|::||:...|.::..|.::......||
  Rat   458 MSLLFLVFFECVSISWFYGVNRFYDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFLFSAVQMTPL 522

  Fly   539 TYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIYQQPG----------KTFGSKFGLAMQPTAN 593
            |.....:|.         ||.||..|  .||.::...||          .:...:..:.:||:.:
  Rat   523 TMGSYVFPK---------WGQGVGWL--MALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQPSED 576

  Fly   594 W-----GPLQTQ-----KFEAYI 606
            .     ||.|.|     ..||||
  Rat   577 IVRPENGPEQPQAGSSASKEAYI 599

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 166/478 (35%)
Slc6a1NP_077347.1 SLC6sbd_GAT1 2..599 CDD:212075 196/607 (32%)
PDZ-binding 597..599 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107413519
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.