DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and slc6a4a

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001035061.1 Gene:slc6a4a ZFINID:ZDB-GENE-060314-1 Length:646 Species:Danio rerio

Alignment Length:571 Identity:201/572 (35%)
Similarity:308/572 (54%) Gaps:51/572 (9%)


  Fly    18 QGSREGHPGSNDGISTVIYSAEGEELTINCEAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWR 82
            |..:||.....|.::|     .|...|:..: ::.....|:.||:.::||.|.|..:|.||||||
Zfish    58 QSPKEGAGTGTDRVNT-----PGTFRTLVVQ-QTSLDPPRETWSKKMDFLLSVIGYAVDLGNVWR 116

  Fly    83 FPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAF-DMAPIMRGIAYGQVYST 146
            ||:|..:|||||||:||:::.:..|.|::|:|:.:|||...|||..: .:.||.:||.:......
Zfish   117 FPYICYQNGGGAFLLPYLLMAVFGGVPLFYMELALGQFHRSGCISIWKHVCPIFKGIGFAICIIA 181

  Fly   147 ALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWG-KSCVATGATAANDSSIVQGVSSAELFFT 210
            .....||..|||..:.||::||...||||.|...|. .:|....:|..|.|.....:|.||.|:.
Zfish   182 LYIAFYYNTIMAWALYYLLSSFRATLPWTTCNNRWNTPNCTHYLSTDLNVSWTNNSISPAEEFYV 246

  Fly   211 QTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIR 275
            :.||:...|...:.||..||.|.||||..:.::...:.||:::|||..:..|.|||:::::||||
Zfish   247 RQVLQVHLSPGLHQLGWVSWQLALCLLFIFTVVYFSIWKGVKTSGKVVWVTATFPYLVLLILLIR 311

  Fly   276 AVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVII 340
            ..||||||:|:|::|||.|.:||...||..|..|:||||...||.|:.:||:|.|:.|.:||.:|
Zfish   312 GATLPGAWRGVVFYLKPDWKKLLTTTVWLDAAAQIFFSLGPGFGVLLAFASYNPFHNNCYKDALI 376

  Fly   341 ITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVK-GGAGLAFISYPEAIAKFKYLP--QLFA 402
            .::::.|||.|:|.:||.:||.:| |...:.:..|.| .|..|.||.|.||||.   :|  ..||
Zfish   377 TSSVNCLTSFLSGFVIFTVLGYMA-EMRQQGVETVAKDAGPSLLFIIYAEAIAN---MPAATFFA 437

  Fly   403 VLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHL----PHWLLAVSASIIGFLC-----GLVYMTP 458
            ::||.|:::||:.|.......|:..:.|.|.||    ..|.      ::|.:|     .|..:|.
Zfish   438 IIFFLMIIMLGLDSTFAGLEGVITAMLDEFPHLLARRREWF------VLGLVCVCYLGALSTLTY 496

  Fly   459 GGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAP-G 522
            ||.||:.|.:.|......:.:...|::||.|.||..|.|:|::.||......:||:||..:.| .
Zfish   497 GGAFVVKLFEEYATGPAVITVVFLEVIAVSWFYGTTRFCNDVQLMLGFAPGLFWRVCWIAICPCF 561

  Fly   523 LMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIY 573
            |:|:::.::.|            ||...:..::        .|||..|..|
Zfish   562 LLFIIVSFLAF------------PPEVKLFDYL--------YPFWTTVLGY 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 185/489 (38%)
slc6a4aNP_001035061.1 SLC5-6-like_sbd 91..628 CDD:294310 194/533 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107490053
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.