DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and si:ch211-132b12.2

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001038688.1 Gene:si:ch211-132b12.2 ZFINID:ZDB-GENE-050420-178 Length:582 Species:Danio rerio

Alignment Length:574 Identity:191/575 (33%)
Similarity:314/575 (55%) Gaps:25/575 (4%)


  Fly    56 QRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQF 120
            :|..|....||:.:...:.:|||||||||::..:|||||||:||::.::..|.|::.||..:||:
Zfish    10 ERGNWGSKTEFILAVAGIVIGLGNVWRFPYLCYKNGGGAFLVPYLVFVVTCGVPLFLLETAMGQY 74

  Fly   121 SSRGCIRAFD-MAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWG-K 183
            :..|.|..:. :.|:..||.|........:..||..|:|..:.||..|||..|||..|...|. .
Zfish    75 TQEGGITCWHRLCPLAEGIGYAGQLIVLYSCMYYIIILAWALFYLAFSFSSQLPWASCDNIWNTD 139

  Fly   184 SCVATGATAANDSS--IVQGVSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTI 246
            :||.......|.|:  ::...||...|:...||.....::.  :|..:|:::|||:..|:|....
Zfish   140 ACVNLAENKLNLSTPMLLNSTSSVTEFWQHRVLALSGGIEK--VGKINWEILLCLIVMWIICYFC 202

  Fly   247 LSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMF 311
            :.||::|:||..||.|.||||:::|||||.:|||||.||:|::|.|:.::|.:|.||..|..|:|
Zfish   203 VWKGVKSTGKVVYFTATFPYVMLLVLLIRGLTLPGALQGVVFYLYPEPARLADPQVWMEAGAQIF 267

  Fly   312 FSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVV 376
            ||.|:...:|.:..|:|.:|.|.::..:.:..::|.||::||..:|.:||.:| :.....|.:|.
Zfish   268 FSYALGTASLTVLGSYNKYNYNCYRSSLWLCLLNSSTSVIAGFAVFSVLGFMA-QKQGLPIEEVA 331

  Fly   377 KGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHL-----P 436
            :.|.|||||:||:|:|...: |||:|..||.|:::||:.:........:..|.|.|..:     .
Zfish   332 ESGPGLAFIAYPQAVAMMPF-PQLWAACFFIMIILLGLDTQFVAMEVFMTSVIDLFPTVLRKAGR 395

  Fly   437 HWLLAVSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALV-LAIAELLAVGWIYGVKRICSDI 500
            ..:..:...:..|...||.:|.||.:|..|.|:|.|:...|: |.:.|.||:||::|.:::...|
Zfish   396 REIFLLLFCLFCFFGQLVMVTEGGMYVFQLFDYYACSGACLLFLCVFESLAMGWVFGAEKMFGII 460

  Fly   501 EFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTY-RGVQYPPVYYMAGWIIWGLGVLQL 564
            |.|.|.:.::::.:||..:.|.:.....|..|..|:|||: |...||...|:.||::....:|.:
Zfish   461 EDMTNSRPNYWFMLCWKYLTPIVSLASFVCSLVKYKPLTFNRWYVYPDWAYVLGWLLALSSILLV 525

  Fly   565 PFWALVTIYQQPGKTFGSKFGLAMQPTANWGPLQTQKFEAYIIHRKREADFKSP 618
            |.|||       |:.|..|..:..:.:....|.....|...|.:::.|   |:|
Zfish   526 PGWAL-------GRMFAGKGSIKQRWSHLCSPDTNPHFACKIQNKRHE---KTP 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 165/484 (34%)
si:ch211-132b12.2NP_001038688.1 SLC6sbd-TauT-like 11..550 CDD:271387 185/550 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107507423
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.