DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and slc6a22.2

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_005166102.1 Gene:slc6a22.2 ZFINID:ZDB-GENE-030616-628 Length:608 Species:Danio rerio

Alignment Length:540 Identity:191/541 (35%)
Similarity:292/541 (54%) Gaps:33/541 (6%)


  Fly    57 RDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFS 121
            |:||:..:|||.:.....:|||||||||::..:||||||.:|||:.|...|.|:::||..:|||:
Zfish    28 REQWANKLEFLLAVAGHIIGLGNVWRFPYLCYKNGGGAFFVPYVLFLFTCGIPLFFLETSLGQFT 92

  Fly   122 SRGCIRAF-DMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWG-KS 184
            |:|.|..: .:.|:..|:.:|..........||..|:|....||.:||:..|||..|...|. .|
Zfish    93 SQGGITCWRKICPLFEGLGFGSQVVVLYTGVYYIIILAWAFLYLFSSFTSELPWASCNNYWNTPS 157

  Fly   185 CVATGATAANDSSIVQGVSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSK 249
            |:....:...:.|..:..|....|:.:.:|.....::.  :|...|||.||||..|:|....:.|
Zfish   158 CMEFSESNITEYSPNKTTSPVIEFWERRILGLSGGIEQ--IGNVRWDLALCLLLAWIICYFCVWK 220

  Fly   250 GIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSL 314
            |::|:||..||.|.|||:::||||:|.:|||||..||.::|.|..|:|.:|.||..|.:|:|:|.
Zfish   221 GVKSTGKVVYFTATFPYLMLIVLLVRGLTLPGAINGITFYLYPDPSRLKDPQVWMDAGSQIFYSY 285

  Fly   315 AICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGG 379
            .:|.|.|....|:|.::.|.::|.:.:..::||||.:||..||.:||.:|.|... |||.|.:.|
Zfish   286 GVCTGVLTALGSYNKYDNNCYRDCVYLCLLNSLTSFVAGFAIFSVLGFMADEQGV-DISLVAESG 349

  Fly   380 AGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFT------HLPHW 438
            .|||||:||.|:|... ||||:|:.||.|::.||:.|......|:|..:.|.:.      |...:
Zfish   350 PGLAFIAYPRAVALMP-LPQLWAIFFFIMIIFLGLDSEFVYQEALVTSISDMYPSFFQVGHRRKF 413

  Fly   439 LLAVSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALV-LAIAELLAVGWIYGVKRICSDIEF 502
            ||....| ..|..||:.:|.||.:|..|.|:|.|:.:.|: .||.:.:.|||:||..|....:|.
Zfish   414 LLLFICS-ASFFVGLLMVTEGGLYVFQLFDYYACSGMTLLTFAILQSICVGWVYGADRHYDCVED 477

  Fly   503 MLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRG-VQYPPVYYMAGWIIWGLGV----- 561
            |:..:...:.:.||..:.|.:.....::.|..|.||.:.. .:||       |  ||..:     
Zfish   478 MIGYRPWPFMKCCWKYLTPAICTGTFIFSLVQYTPLKFNNEYEYP-------W--WGYAIGGFFT 533

  Fly   562 ----LQLPFWALVTIYQQPG 577
                |.:|.|.:..:...||
Zfish   534 LSSTLLVPLWMIYLVGTTPG 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 176/483 (36%)
slc6a22.2XP_005166102.1 SLC6sbd-TauT-like 28..565 CDD:271387 191/541 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107541273
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.