DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and slc6a6a

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001119858.1 Gene:slc6a6a ZFINID:ZDB-GENE-081104-1 Length:625 Species:Danio rerio

Alignment Length:593 Identity:210/594 (35%)
Similarity:323/594 (54%) Gaps:44/594 (7%)


  Fly     5 AEYQKLRRNMQGAQGSREGHPGSNDGISTVIYSAEGEELTINCEAESESSG---QRDQWSRGVEF 66
            |:.:||:......:.:.:..||.:.|                ...|.|:.|   ||::|:..::|
Zfish     2 AQKEKLQCLKDFHKDTLKPSPGKSPG----------------TRPEDEAEGKAPQREKWASKLDF 50

  Fly    67 LFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAF-D 130
            :.|.....||||||||||::..:||||||||||.|.|...|.||::|||.:|||:|.|.|..: .
Zfish    51 VLSVAGGFVGLGNVWRFPYLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSEGGITCWGK 115

  Fly   131 MAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWG-KSCV-------A 187
            :.||..||.|..:...:|...||..|:|..:.||:..|...|||..|...|. ::||       .
Zfish   116 LCPIFTGIGYASIIIVSLLNIYYIVILAWGLYYLLQCFQHELPWARCRHSWNTENCVEDTVRKNK 180

  Fly   188 TGATAANDSSIVQGVSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIR 252
            |...:||.::....|:.   |:.:.||.....:|:  :|...|:|.|||||.|||....:.||::
Zfish   181 TLWLSANATNFTSPVTE---FWERNVLSISSGIDE--VGGLKWELALCLLAVWVICFFCIWKGVK 240

  Fly   253 SSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAIC 317
            |:||..||.|.||::::||||||.||||||.:||.::|.|..|:|.:|.||..|.||:|||.|||
Zfish   241 STGKVVYFTATFPFLMLIVLLIRGVTLPGATEGIKFYLYPDLSRLKDPEVWIDAGTQIFFSYAIC 305

  Fly   318 FGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGGAGL 382
            .|.:....|:|.:..|.::|.:::..::|.||.::|..||.:||.:|.|.... |:.|.:.|.||
Zfish   306 LGAMTSLGSYNKYKYNCYRDCMLLGCLNSGTSFVSGFAIFSVLGFMAQEQGIA-IADVAESGPGL 369

  Fly   383 AFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNI----GMASAVVNVVKD--RFTHLPHWLLA 441
            |||:||:|:.... ||.::|:|||.|||:||:.|..    |..:::|::...  |..:.....:|
Zfish   370 AFIAYPKAVTMMP-LPTVWAILFFIMLLLLGLDSQFVEVEGQITSLVDLYPSLLRKGYRREIFIA 433

  Fly   442 VSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALV-LAIAELLAVGWIYGVKRICSDIEFMLN 505
            | ..:|.:|.||..:|.||.:|..|.|:|..:.:.|: :|..|.:||.|:||.......||.|:.
Zfish   434 V-ICVISYLLGLTMVTKGGMYVFQLFDYYAASGVCLLWVAFFECVAVAWVYGADNFYDAIEDMIG 497

  Fly   506 VKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGV-QYPPVYYMAGWIIWGLGVLQLPFWAL 569
            .:.:.:.:..|.::.|.|.....|:.|..|:||||..: :||......||.:....::.:|...:
Zfish   498 YRPNSWMKWSWMLITPVLCVGCFVFSLVKYKPLTYNKLYKYPDWSIGLGWALALASMICIPMMVV 562

  Fly   570 VTIYQQPG 577
            :.|.|..|
Zfish   563 IKIIQSDG 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 185/490 (38%)
slc6a6aNP_001119858.1 SLC6sbd_TauT 41..582 CDD:271398 200/539 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C106525983
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.