DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and SLC6A20

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_064593.1 Gene:SLC6A20 HGNCID:30927 Length:592 Species:Homo sapiens

Alignment Length:613 Identity:193/614 (31%)
Similarity:306/614 (50%) Gaps:123/614 (20%)


  Fly    57 RDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFS 121
            |..|:..::|:|:||:.:||||||||||::....|||:||:||:|:|::.|.|:.|||:.:||..
Human     5 RPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLYLELAVGQRM 69

  Fly   122 SRGCIRAF-DMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVE----- 180
            .:|.|.|: .::|.:.|:....|..:...:.||..|.|....||..||.:.|||:.|.:.     
Human    70 RQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDPLPWSVCPLNGNHTG 134

  Fly   181 WGKSCVATGATAANDSSIVQGVSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGT 245
            :.:.|              :..||.:.|:.:..|....||.:|| |. .|:..||||..|:::..
Human   135 YDEEC--------------EKASSTQYFWYRKTLNISPSLQENG-GV-QWEPALCLLLAWLVVYL 183

  Fly   246 ILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQM 310
            .:.:|..|:||..||.|..||.::|:.|||.:||.||..|::|...|:..||.||..|..|.||:
Human   184 CILRGTESTGKVVYFTASLPYCVLIIYLIRGLTLHGATNGLMYMFTPKIEQLANPKAWINAATQI 248

  Fly   311 FFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLA---FE------ 366
            ||||.:.||:|:.:||:|:.:.|..|..||::.|:|.|||.|..:.|.|.|..|   :|      
Human   249 FFSLGLGFGSLIAFASYNEPSNNCQKHAIIVSLINSFTSIFASIVTFSIYGFKATFNYENCLKKV 313

  Fly   367 ----TNTKDIS---------QVVKG-------------------------------GAGLAFISY 387
                |||.|:.         :.|||                               |.|||||.|
Human   314 SLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQGTGLAFIVY 378

  Fly   388 PEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDR---FTHLPHWLLAVSASIIGF 449
            .|||...: :.||::||:|||||:|||||.:|..:|::..:.|.   .:|||...::....::..
Human   379 TEAIKNME-VSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTDSKIISSHLPKEAISGLVCLVNC 442

  Fly   450 LCGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRI 514
            ..|:|:....|.:..::.:.|..|...|::.:.|.:||.::||::|..||::.|.....|:||::
Human   443 AIGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAVCYVYGLRRFESDLKAMTGRAVSWYWKV 507

  Fly   515 CWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIYQQPGKT 579
            .||.|:|     :|:..||              |:|::.:|:  .|.|:...|            
Human   508 MWAGVSP-----LLIVSLF--------------VFYLSDYIL--TGTLKYQAW------------ 539

  Fly   580 FGSKFGLAMQPTANWGPLQTQKFEAYII 607
                       .|:.|.|.|:.:.||.:
Human   540 -----------DASQGQLVTKDYPAYAL 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 178/536 (33%)
SLC6A20NP_064593.1 SLC6sbd_SIT1 2..577 CDD:271401 193/614 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107255548
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.