DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and slc6a1b

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001007363.1 Gene:slc6a1b ZFINID:ZDB-GENE-041114-57 Length:600 Species:Danio rerio

Alignment Length:634 Identity:209/635 (33%)
Similarity:323/635 (51%) Gaps:81/635 (13%)


  Fly    16 GAQGSREGH--------PGSNDGISTVIYSAEGEELTINCEAESESSGQRDQWSRGVEFLFSCIA 72
            |.:.| :||        |.:||...|::...:          :.:....|:.|....:||.||:.
Zfish     5 GTKAS-DGHVLTEVNEAPTANDKPKTLVVKVQ----------KKKELPDRETWQGKFDFLLSCVG 58

  Fly    73 LSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRG 137
            .::|||||||||::..:||||||||||.:.|:..|.|:::||..:||::|.|.:..:.:||:.:|
Zfish    59 YAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFFLETALGQYTSIGGLGVWKLAPMFKG 123

  Fly   138 IAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWGKSCVATGATAANDSSIVQGV 202
            :.......:.....||..|:|..|.||..||:..|||..|...|......:..:.||    :..:
Zfish   124 VGLAAAVLSFWLNIYYIVIIAWAIYYLYNSFTTDLPWKSCDNPWNTDKCFSNYSMAN----IGNM 184

  Fly   203 SSAELFFTQTVLREPESLDDNGLGTPS---WDLVLCLLATWVIIGTILSKGIRSSGKASYFLALF 264
            :||.:.|.:   |....|.| ||..|.   ..|.:.|...||::...:.||:..:||..||.|.:
Zfish   185 TSAVVEFWE---RNMHQLTD-GLEKPGEIRLPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATY 245

  Fly   265 PYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFND 329
            ||.::.:|.||.||||||.:||::::.|::|:|....||..|.||:|||..:..|:|:...|:|.
Zfish   246 PYFMLFILFIRGVTLPGAKEGILFYVTPEFSKLKESEVWLDAATQIFFSYGLGLGSLIALGSYNP 310

  Fly   330 FNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKF 394
            ||.||:||.||:..|:|.||:.||.:||.|:|.:|..|. :.|:.|...|.||||::||||:.:.
Zfish   311 FNNNVYKDSIIVCCINSFTSMFAGFVIFSIVGFMAHITK-RPIADVAASGPGLAFLAYPEAVTQL 374

  Fly   395 KYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHLPHWL-------LAVSASIIGFLCG 452
            ...| |:|||||.|||:|||.|........:..:.|.|   |..|       :|| ..::.:|.|
Zfish   375 PISP-LWAVLFFSMLLMLGIDSQFCTVEGFITALVDEF---PRALRGRREIFIAV-VCLVSYLIG 434

  Fly   453 LVYMTPGGQFVLNLVDFYGCTFIALV-LAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRICW 516
            |..:|.||.:|..|.|:|..:.:.|: |...|.:::.|.|||.:...::|.|:..|...:|::||
Zfish   435 LSNITQGGLYVFKLFDYYSASGMCLLFLVFFECVSISWFYGVNKFYGNLEEMIGYKPCIWWKLCW 499

  Fly   517 AIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFW--ALVTIYQQPG-- 577
            .:..|.::..|.::......|||.....:|.         ||.||    .|  ||.::...||  
Zfish   500 VVFTPLIVAGVFLFSAVQMVPLTLNNYVFPK---------WGQGV----GWCMALSSMVLIPGYM 551

  Fly   578 --------KTFGSKFGLAMQPTA------NWGPLQTQK------FEAYI 606
                    .::..:..:.:||||      ..||.|..:      .||||
Zfish   552 GYMFLTLKGSYKERLRIMIQPTAAAVRTQENGPEQQPENPTPANDEAYI 600

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 176/485 (36%)
slc6a1bNP_001007363.1 SLC5-6-like_sbd 2..600 CDD:294310 208/633 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107401667
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.