DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and slc6a22.1

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_005166076.1 Gene:slc6a22.1 ZFINID:ZDB-GENE-030616-629 Length:584 Species:Danio rerio

Alignment Length:571 Identity:207/572 (36%)
Similarity:316/572 (55%) Gaps:25/572 (4%)


  Fly    48 EAESESSGQ----RDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGR 108
            :|:|..:|.    |.|||..|||:.:.....:|||||||||::..:||||.|.||||:.|...|.
Zfish    17 DAQSNETGLKTQIRGQWSSKVEFILAVAGQIIGLGNVWRFPYLCYKNGGGVFFIPYVVFLFACGI 81

  Fly   109 PVYYLEVIIGQFSSRGCIRAF-DMAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVL 172
            |::.:|..:||::|:|.:..: .:.|:..|:.||.......::.||..|:|....||.:|||..|
Zfish    82 PLFLMETALGQYTSQGSVTCWRKICPLFEGLGYGSQVVVLYSSAYYIIILAWAFFYLFSSFSGEL 146

  Fly   173 PWTYCLVEW-GKSCVATGAT--AANDSSIVQGVSSAELFFTQTVLREPESLDDNGLGTPSWDLVL 234
            ||..|...| .::||.....  |.|.|.:....|..:.|:.:.||....|:  |.||:..|:|.|
Zfish   147 PWASCRNWWNSENCVEFDRMQGAKNLSFMANASSPVKEFWERRVLNITGSV--NELGSVRWELAL 209

  Fly   235 CLLATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLN 299
            |||..|||....:.||::|:||..||.|.||||:::|||||.:|||||..||.::|.|..::|.:
Zfish   210 CLLLAWVICYFCVWKGVKSTGKVVYFTATFPYVMLMVLLIRGLTLPGAIDGITFYLYPNPARLAD 274

  Fly   300 PHVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLA 364
            |.||..|.||:|:|.|:|.|.|....|:|.:|.|.:||.:.:..::|.||.:||..||.:||.:|
Zfish   275 PQVWMDAGTQIFYSYALCIGCLTALGSYNKYNNNCYKDCVYLCLLNSGTSFVAGFAIFSVLGFMA 339

  Fly   365 FETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSN-IGMASAVVNV- 427
            .|... |||.|.:.|.|||||:||.|:|... :.||:::.||.|:::||:.|. :|:.|.:..: 
Zfish   340 LEQGV-DISVVAESGPGLAFIAYPRAVAMMP-MAQLWSICFFLMIILLGLDSEFVGLESLMTAIT 402

  Fly   428 -VKDRFTHLPH----WLLAVSASIIGFLCGLVYMTPGGQFVLNLVDFYGCTFIALVL-AIAELLA 486
             :...|....|    :||.:  .|..||.||:.:|.||.:|..|.|:|.|:.:.|:| |||:.:.
Zfish   403 DMNPNFFLQGHRRKLFLLVI--CIACFLIGLLMVTEGGLYVFQLFDYYSCSGMTLLLFAIAQSIC 465

  Fly   487 VGWIYGVKRICSDIEFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGV-QYPPVYY 550
            :||.||..|:..:|..|:........:.||..:.|.:.....::.|..:.||.:... :||...|
Zfish   466 IGWFYGADRLYENIADMIGYHPLTLMKYCWKYITPIVCIGTFIFSLVKFTPLKFNNTYEYPWWGY 530

  Fly   551 MAGWIIWGLGVLQLPFWALVTIYQQPGKTFGSKFGLAMQPTANWGPLQTQK 601
            .|||.......|.:|.|.:..|...|| |...:..:...|.::. ||.:::
Zfish   531 AAGWWFTLSSTLLVPIWMIYAILVTPG-TLKQRLRVLCTPASDL-PLTSER 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 184/486 (38%)
slc6a22.1XP_005166076.1 SLC6sbd-TauT-like 30..569 CDD:271387 201/546 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107621626
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.