DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and Slc6a17

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_001280618.1 Gene:Slc6a17 MGIID:2442535 Length:727 Species:Mus musculus

Alignment Length:645 Identity:186/646 (29%)
Similarity:303/646 (47%) Gaps:123/646 (19%)


  Fly     1 MDDDAEYQKLRRNMQGAQGSREGHPGSNDGISTVIYSAEGEELTINCEAESESSGQRDQWSRGVE 65
            :::..:|::...|:.|..|.::              ....|||         .:..|..|:..::
Mouse    27 LEEPVDYKQSVLNVAGETGGKQ--------------KVAEEEL---------DTEDRPAWNSKLQ 68

  Fly    66 FLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFD 130
            ::.:.|..||||||:||||::..:|||||:|:||:::|::||.|:::||:.:||...||.|..:.
Mouse    69 YILAQIGFSVGLGNIWRFPYLCQKNGGGAYLVPYLVLLIIIGIPLFFLELAVGQRIRRGSIGVWH 133

  Fly   131 -MAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVASFSEVLPWTYCLVEWGKSCVATGATAAN 194
             :.|.:.||.:...........||..|:..::.|...||...|||:.|.|      :..|..|..
Mouse   134 YVCPRLGGIGFSSCIVCLFVGLYYNVIIGWSVFYFFKSFQYPLPWSECPV------IRNGTVAVV 192

  Fly   195 DSSIVQGVSSAELFFTQTVLREPESLD-DNGL---GTPSWDLVLCLLATWVIIGTILSKGIRSSG 255
            :....:  |||..:|...     |:|| .|.:   |..:|.:.||||..|.|:|..:.|||:|||
Mouse   193 EPECEK--SSATTYFWYR-----EALDISNSISESGGLNWKMTLCLLVAWSIVGMAVVKGIQSSG 250

  Fly   256 KASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGT 320
            |..||.:|||||::...|:|.:.|.||..||::...|:..::|:|.||..|.||:||:|.:.||.
Mouse   251 KVMYFSSLFPYVVLACFLVRGLLLRGAVDGILHMFTPKLDKMLDPQVWREAATQVFFALGLGFGG 315

  Fly   321 LVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFETN----------------- 368
            ::.::|:|..:.|.|.|..:::.|:..||:||..::|.:||   |:.|                 
Mouse   316 VIAFSSYNKQDNNCHFDAALVSFINFFTSVLATLVVFAVLG---FKANIMNEKCVVENAEKILGY 377

  Fly   369 ---------------------TKDISQV------VK----------------------GGAGLAF 384
                                 |||.|::      ||                      .|.||||
Mouse   378 LNSNVLSRDLIPPHVNFSHLTTKDYSEMYSVIMTVKEKQFPALGLDPCLLEDELDKSVQGTGLAF 442

  Fly   385 ISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHLPHWLLAVSASIIGF 449
            |::.||:..|...| .::|:||.||:.||:||.||..:.:...:.|.| .:|..:..|...:..|
Mouse   443 IAFTEAMTHFPASP-FWSVMFFLMLINLGLGSMIGTMAGITTPIIDTF-KVPKEMFTVGCCVFAF 505

  Fly   450 LCGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFYWRI 514
            ..||:::...|.:.:.:.|.|..|....|:.|.|.:||.||||.|:...::..||..:...::..
Mouse   506 FVGLLFVQRSGNYFVTMFDDYSATLPLTVIVILENIAVAWIYGTKKFMQELTEMLGFQPYRFYFY 570

  Fly   515 CWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLG--VLQLPFWALVTI 572
            .|..|:|      |...:.:...:...||. ||.|  :.||.....  .|..|.||:..:
Mouse   571 MWKFVSP------LCMAVLTTASIIQLGVS-PPGY--SAWIKEEAAERYLYFPNWAMALL 621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 167/545 (31%)
Slc6a17NP_001280618.1 SLC6sbd_NTT4 60..648 CDD:271403 179/590 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105925157
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.