DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and snf-6

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_497416.4 Gene:snf-6 WormBaseID:WBGene00004905 Length:714 Species:Caenorhabditis elegans

Alignment Length:636 Identity:184/637 (29%)
Similarity:315/637 (49%) Gaps:65/637 (10%)


  Fly    36 YSAEG------EELTINCEAESESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGA 94
            |:.||      ||:|    ...:.:..|..||...::|.:.|..:.|:|:.|:|||:..::||.|
 Worm    41 YTREGDIEYPFEEIT----GVGDENRIRGNWSNKSDYLLAVIGFTAGVGSFWKFPFLVFQHGGAA 101

  Fly    95 FLIPYVIVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALATTYYACIMAL 159
            ||:||:.:|.|...|::::|:::|||||...|..:.:.|:.:||.:.||..:.....::..|.|.
 Worm   102 FLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFFNIISAW 166

  Fly   160 TIRYLVASFSEVLPWTYCLVEW-GKSCV---------ATGATAANDSSIVQGVSSAEL------- 207
            |:.||:.|||..:||:.|...| |::|.         ..|....|.|.||:..||.|.       
 Worm   167 TLFYLINSFSFSIPWSNCANSWSGENCTLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHD 231

  Fly   208 --------FFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKGIRSSGKASYFLALF 264
                    :|...||...:.:||  .||.:|.|.||:||.|:.:...|.:|::||||..|...:.
 Worm   232 LGSIPSLKYFQNDVLMLSKGVDD--FGTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIV 294

  Fly   265 PYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPHVWYAAITQMFFSLAICFGTLVMYASFND 329
            |::|:.|||.|.:||.|:...:.|||.|:|..|::.|||..|..|.|:|::.|.|.|...||::.
 Worm   295 PFIILTVLLTRLLTLDGSLAAVFYFLTPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSR 359

  Fly   330 FNKNVHKDVIIITTIDSLTSILAGCII-FGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAK 393
            |:.|::||:.::..:|.:.| |.||:: |..:|...:|.........::.|..|.|:...||:|.
 Worm   360 FHNNIYKDIWLVLIVDVIVS-LVGCLLTFSAIGFTCYEFAISLDKFHIRDGFHLVFVFLAEALAG 423

  Fly   394 FKYLPQLFAVLFFFMLLVLGIGSNIGMASAVVNVVKDRF-----THLPHWLLAVSASIIGFLCGL 453
            ....| |:|.|||.|:|::...:.:.:...:|:.:.|.:     .:..|.|..|.|..|  |..:
 Worm   424 VSVAP-LYAGLFFIMILLVVHATQMFVVETIVSSICDEYPERLRRNRRHVLTTVCALFI--LLSI 485

  Fly   454 VYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDIEFMLNVKTSFY--WRICW 516
            .:....|.|.:.|:..:..|:..:|:|..|.:|:.|:|||..:..:.::::......|  |:|.:
 Worm   486 PFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWIVGYWPPCYIFWKILF 550

  Fly   517 AIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIYQ---QPGK 578
            ..:.|.:...:|.::...:..:.|...|:|....:..|.|....::.:|   :|.|:|   ..| 
 Worm   551 KFICPMVYLAILCFLWLDWNSIQYESYQFPYWSILTAWCIASFPLILIP---IVGIWQFCIAKG- 611

  Fly   579 TFGSKFGLAMQPTANWGPL----QTQKFEAYIIHRKR-----EADFKSPRG 620
            |...|:...:.|...|||.    :.:||...|...:|     |.:..|.||
 Worm   612 TITQKWWRVLYPDDAWGPAMAIHRAEKFPLQIPEARRLLLPPEVEIASSRG 662

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 153/507 (30%)
snf-6NP_497416.4 SLC5-6-like_sbd 64..639 CDD:294310 171/585 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107585828
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.