DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG8850 and snf-12

Sequence 1:NP_725122.2 Gene:CG8850 FlyBaseID:FBgn0033708 Length:629 Species:Drosophila melanogaster
Sequence 2:NP_509527.1 Gene:snf-12 WormBaseID:WBGene00004911 Length:1022 Species:Caenorhabditis elegans

Alignment Length:610 Identity:167/611 (27%)
Similarity:286/611 (47%) Gaps:59/611 (10%)


  Fly    51 SESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYVIVLLLIGRPVYYLEV 115
            |:.:.:|:.|....:|..||:...||:|:..|||....::|||.|.|||:..|:..|.|:.:|.:
 Worm   151 SKQNDRRELWRTQKDFFLSCLGFMVGVGHTMRFPAKVYQHGGGVFFIPYLFSLIFFGLPLVFLHL 215

  Fly   116 IIGQFSSRGCIRAFD-MAPIMRGIAYGQVYSTALATTYYACIMALTIRYLVAS-----FSEVLPW 174
            .:||::.:....||. :.||..|:.:..|........||..|:|..|.|...|     ..:.|||
 Worm   216 SLGQYTGQAANTAFQRLMPIGSGVGWALVVIAIPVAVYYNIIVAWAIHYFFQSAKGLLLGDELPW 280

  Fly   175 TYCLVEW---GKSCVATGATAANDSSIVQGVSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCL 236
            ..|..||   .:.|......:..:|:  ..:::.|.||...|| ...:..|..||.....|||.|
 Worm   281 ETCRDEWQLDNRCCNLHNLHSCFNST--NSITAPEAFFHSEVL-SLSTFGDFALGPLQSHLVLSL 342

  Fly   237 LATWVIIGTILSKGIRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNPH 301
            .|.|:::...:.||:.|..:.....|..||:::.:||:|.::||||.:|:.:......::|....
 Worm   343 AAAWLLVFFGVFKGLGSIAQTMNVTATVPYLLLSILLLRGISLPGANKGLTFLFTVDSTKLWKWQ 407

  Fly   302 VWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSILAGCIIFGILGNLAFE 366
            :|.:|..|:|:.|.|..|.|:..|:|:.:..|:::|.:::..:|:|||.|:|.:||..:|.:|.|
 Worm   408 IWKSAAEQVFYELGIDAGPLISMAAFSRYRNNIYRDSVLLVIMDALTSCLSGMVIFSFVGFIASE 472

  Fly   367 TNTKDISQVVK-GGAGLAFISYPEAIAKFKYLPQLFAVLFFFMLLVLGIGSNIG----MASAVVN 426
            :|: :::.|:| ....|:|..|| .:..|.|...|:|.|||.||::..|.:...    :|||.:|
 Worm   473 SNS-NVNDVLKHDPLYLSFTVYP-GVTSFMYWGGLWATLFFGMLVLAAIDAEFAWLEMIASAFMN 535

  Fly   427 VVKDRFTHLPHWLLAVSASIIGFLC------GLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELL 485
                   |......||...::.|||      ||.....||.||.:.::.....:.:..||:..:.
 Worm   536 -------HFSMKNKAVENRLLAFLCLAGFFLGLPLCAQGGIFVFHAIENLNANWNSFSLALLSVA 593

  Fly   486 AVGWIYGVKRICSDIEFMLNVKT--------------------SFYWRICWAIVAPGLMFLVLVY 530
            .|.::||:....:||..||.|..                    ..|.:.....:.|.::.::||.
 Worm   594 IVCYVYGIDNYLTDISAMLRVPRIQISKATRLKEKLIYFFGPGGIYIKFSLCFICPVILTVLLVA 658

  Fly   531 MLFSYEPLTYRGVQYPPVYYMAGWIIWGLGVLQLPFWALVTIYQ--QPGKTFGSKFGLAMQPTAN 593
            .:..|:.:::.|...|..|.:..||:....:|.:|..|.:.|.|  ..||...|.|     .|:.
 Worm   659 SVLGYQRISFAGRPIPIDYEIVAWIVMIGPLLVVPLVAFMQIRQIRNEGKLLKSLF-----DTSE 718

  Fly   594 WGPLQTQKFEAYIIHRKREADFKSP 618
            |...|....|...::.::...|:||
 Worm   719 WRESQDDSLEPKDLYMRQSGKFESP 743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG8850NP_725122.2 SLC6sbd 58..532 CDD:271359 143/514 (28%)
snf-12NP_509527.1 SLC6sbd 158..660 CDD:271359 143/514 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107475927
eggNOG 1 0.900 E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.